LexiTopic: Writing and Publishing
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to WRITING AND PUBLISHING in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to WRITING AND PUBLISHING
SUBJECT HEADINGS IN THIS LEXITOPIC:
Handwriting and Writing MaterialsJournalismLiterary Styles, Devices, and TechniquesPeople in Writing and PublishingPoetry and Poetic FormsProse Genres and FormsPublishing: Design and Layout print and digitalPublishing: Print Production the physical itemPublishing: Publication Elements contentPublishing: Types of PublicationsWriting and Editing processWriting: Others
NOTES ABOUT THE TAXONOMY FOR WRITING AND PUBLISHING
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to all types of writing and publications, including genres, writing and editing, publishing materials and processes, journalism, and more.
Words related exclusively to online publishing and publications (e.g., blog) are in INFORMATION AND COMMUNICATION TECHNOLOGIES.
Words related to stage plays, screenwriting, films, etc., are in DRAMATIC ARTS.
Words related to language, grammar, etc., are in WORDS AND LANGUAGE.
Words related to drawing and drawing materials are in VISUAL ARTS.
Topical arrangement of Spelling Bee words related to WRITING AND PUBLISHING
Handwriting and Writing Materials
BACKHAND: handwriting whose strokes slant downward from left to rightBLANK: free from writing or marks (a blank sheet of paper) or having spaces to be filled in (a blank application form)CHALK: a prepared form of chalk or a material resembling chalk especially when used (as for writing on blackboards) as a crayon; also, a mark made with chalk; also, to write or draw with chalk; to rub or mark with chalkCHALKED: to write or draw with chalk; to rub or mark with chalkCRAYON: a stick of white or colored chalk or of colored wax used for writing or drawingHAND: style of penmanship: handwriting (wrote in a fancy hand); also, a signatureILLEGIBILITY: not legible: indecipherableILLEGIBLE: not legible: indecipherableILLEGIBLY: not legible: indecipherableINITIAL: to affix an initial to; to authenticate or give preliminary approval to by affixing the initials of an authorizing representativeINITIALING: to affix an initial to; to authenticate or give preliminary approval to by affixing the initials of an authorizing representativeINKWELL: a container (as in a desk) for inkJOTTED: to write briefly or hurriedly: set down in the form of a noteLAPBOARD: a board used on the lap as a table or deskLEAD: a thin stick of marking substance (such as graphite) in or for a pencilLEGIBILITY: capable of being read or deciphered: plain (legible handwriting)LEGIBLE: capable of being read or deciphered: plain (legible handwriting)LEGIBLY: capable of being read or deciphered: plain (legible handwriting)LONGHAND: handwriting: such as characters or words written out fully by hand, or cursive writingMARK: to make notations in or on; to make note of in writing: to jot (marking the date in his journal); a written or printed symbol (such as a comma or colon); also, a cross made in place of a signature; also, to indicate by a mark or symbol (mark an accent); also, to designate as if by a mark; to register, recordPAPYRI: plural of papyrus, a writing on papyrus; a written scroll made of papyrusPENCIL: an artist's brush; also, an implement for writing, drawing, or marking consisting of or containing a slender cylinder or strip of a solid marking substance; also, to paint, draw, write, or mark with a pencilPENCILED: an artist's brush; also, an implement for writing, drawing, or marking consisting of or containing a slender cylinder or strip of a solid marking substance; also, to paint, draw, write, or mark with a pencilPENMAN: a calligrapher; a copyist or scribe; a person with a specified quality or kind of handwritingPENMEN: not in M-W, but in Collins: plural of penman, a calligrapher; a copyist or scribe; a person with a specified quality or kind of handwritingPOTHOOK: a written character resembling a pothookPRINT: to write in letters shaped like those of ordinary roman text type; to write or hand-letter in imitation of unjoined printed charactersPROTRACTOR: an instrument for laying down and measuring angles in drawing and plottingQUILL: a pen for writing that is made from the quill of a featherROUND: of or relating to handwriting predominantly curved rather than angularRUNNING: of handwriting (adj) cursive, flowing; also, to mark out: to draw (run a contour line on a map) (running a line through unneeded listings)TABLET: a thin slab or one of a set of portable sheets used for writing; also, a pad, a collection of sheets of paper glued or fastened together at one endTAKE: to get in or as if in writing (take notes, take an inventory)TAKEN: to get in or as if in writing (take notes, take an inventory)TITTLE: a point or small sign used as a diacritical mark in writing or printingTOOK: to get in or as if in writing (take notes, take an inventory)VELLUM: a fine-grained unsplit lambskin, kidskin, or calfskin prepared especially for writing on or for binding books; also, of, resembling, or bound in vellum; also, a strong cream-colored paperWEDGE: the wedge-shaped stroke in cuneiform charactersWORD: a written or printed character or combination of characters representing a spoken word; any segment of written or printed discourse ordinarily appearing between spaces or between a space and a punctuation markWRIT: something written: writing
Journalism
ANGLE: to present (something, such as a news story) from a particular or prejudiced point of view; slantANGLED: to present (something, such as a news story) from a particular or prejudiced point of view; slantANGLING: to present (something, such as a news story) from a particular or prejudiced point of view; slantBEAT: journalism: a group of news sources that a reporter covers regularlyCOLUMN: one in a usually regular series of newspaper or magazine articlesCOPY: something considered printable or newsworthy —used without an articleDAILY: issued every day or every weekday (a daily newspaper); also, a newspaper that is published every day or every day except SundayEDIT: to direct the publication of (edits the daily newspaper)EDITED: to direct the publication of (edits the daily newspaper)EDITION: a usually special issue of a newspaper (as for a particular day or purpose) (Sunday edition, international edition); one of the usually several issues of a newspaper in a single day (city edition, late edition)EMBED: to attach (a journalist) to a military unit for the purpose of covering a conflictEMBEDDED: to attach (a journalist) to a military unit for the purpose of covering a conflictGAGGLE: a gaggle of reporters and photographersGONZO: of, relating to, or being a style of journalism marked by a lack of objectivity due to the writer's immersion in the subject and often participation in the activity being documentedHEADLINE: adjective: deserving mention in a headline: very noteworthy (the headline abduction of a diplomat); also, headlines plural: front-page news (the scandal made headlines); also, words set at the head of a passage or page to introduce or categorize; also, to provide with a headlineHEADLINED: a head of a newspaper story or article usually printed in large type and giving the gist of the story or article that follows; also, to provide with a headlineJOURNAL: a daily newspaper; also, a periodical dealing especially with matters of current interestJOURNO: M-W’s only def.: chiefly British: a journalist, a person engaged in journalism, especially: a writer or editor for a news mediumKILL: to mark for omission; to delete (to kill a quote)KILLED: to mark for omission; to delete (to kill a quote)KILLING: to mark for omission; to delete (to kill a quote)LEAD: an introductory section of a news story: the lede; also, a news story of chief importanceLEDE: the introductory section of a news story that is intended to entice the reader to read the full storyLEGMAN*: a reporter assigned usually to gather informationLEGMEN*: a reporter assigned usually to gather informationLIBRARY: a morgue, a collection of reference works and files of reference material in a newspaper or news periodical officeMEDIA: singular or plural in construction: mass media; also, medias plural: members of the mass media; also, plural of medium: a channel or system of communication, information, or entertainment; a publication or broadcast that carries advertisingMEDIUM: a channel or system of communication, information, or entertainment; a publication or broadcast that carries advertisingNOTICE: a short critical account or review (The play received good notices.); also, to reviewNOTICING: a short critical account or review (The play received good notices.); also, to reviewOBIT: an obituary, a notice of a person's death usually with a short biographical accountPAPARAZZI: plural of paparazzo, a freelance photographer who aggressively pursues celebrities for the purpose of taking candid photographs, Italian, from Paparazzo, surname of such a photographer in the film La dolce vita (1959) by Federico FelliniPIECE: a literary, journalistic, artistic, dramatic, or musical compositionPOOL: a group of journalists from usually several news organizations using pooled resources (such as television equipment) to produce shared coverage especially of events to which access is restrictedRUNNING: to carry in a printed or broadcast medium (every news outlet ran the story); to appear in print or a broadcast medium (The show ran for five seasons.)
Literary Styles, Devices, and Techniques
ACTION: an event or series of events forming a literary composition; the unfolding of the events of a drama or work of fiction: PLOT; the movement of incidents in a plotANAPHORA: repetition of a word or expression at the beginning of successive phrases, clauses, sentences, or verses especially for rhetorical or poetic effect or use of a grammatical substitute (such as a pronoun or a pro-verb) to refer to the denotation of a preceding word or group of wordsANTICLIMACTIC: of, relating to, or marked by anticlimax, the usually sudden transition in discourse from a significant idea to a trivial or ludicrous idea, or an event, period, or outcome that is strikingly less important or dramatic than expectedAWKWARD: lacking ease or grace (as of movement or expression) (awkward writing)AWKWARDLY: lacking ease or grace (as of movement or expression) (awkward writing)BAGGY: loosely constructed and inflated with inessential elements (e.g., a baggy novel)BODY: the main part of a literary or journalistic work (e.g., the body of the article)BONE: the basic design or framework (as of a play or novel)CALLBACK: something (such as a comment, image, or character) that evokes an earlier instanceCAMEO: usually brief literary or filmic piece that brings into delicate or sharp relief the character of a person, place, or eventCARRY: to convey itself to a reader or audience (an idea carries)CARRYING: to convey itself to a reader or audience (an idea carries)CHOPPY: disconnected (choppy writing)CLOTHE: to express or enhance by suitably significant language: to couch (treaties clothed in stately phraseology)COLOR: vividness or variety of effects of language; local color: the presentation of the features and peculiarities of a particular locality and its inhabitants in writingCOLOUR*: chiefly British spelling of color; vividness or variety of effects of language; local color: the presentation of the features and peculiarities of a particular locality and its inhabitants in writingCONCEIT: an organizing theme or conceptCONCEPT: organized around a main idea or theme (a concept album)COUCH: to phrase or express in a specified manner (The comments were couched in strong terms.)COUCHED: to phrase or express in a specified manner (The comments were couched in strong terms.)COUCHING: to phrase or express in a specified manner (The comments were couched in strong terms.)DECENCY: literary decorumDENOUEMENT: or less commonly dénouement, the final outcome of the main dramatic complication in a literary workDEPICT: to represent or give an account of in words; to describeDEPICTED: to represent or give an account of in words; to describeDEVICE: something (such as a figure of speech) in a literary work designed to achieve a particular artistic effectDIALOG: less common variant of dialogue: the conversational element of literary or dramatic composition (very little dialogue in this film; she writes realistic dialogue); also, to express in dialogue (… and dialogued for him what he would say …—Shakespeare);DRAMATIC: literature: of or relating to dramaDRYLY: dry: wearisome, uninteresting (dry passages of description, a dry lecturer, lecturing or writing dryly); also, marked by matter-of-fact, ironic, or terse manner of expression (a dry wit, has a very dry sense of humor, joking dryly)EDGE: incisive or penetrating quality (writing with a satirical edge)ELEGIAC: of, relating to, or comprising elegy or an elegy, especially: expressing sorrow often for something now pastELLIPTIC: of, relating to, or marked by extreme economy of speech or writing; also, of or relating to deliberate obscurity (as of literary or conversational style)
ELLIPTICAL: variant, or elliptic: of, relating to, or marked by extreme economy of speech or writing; also, of or relating to deliberate obscurity (as of literary or conversational style)EXPLICIT: open in the depiction of nudity or sexuality (explicit books and films)
FLORID: very flowery in style: ornate (florid prose, florid declamations); also: having a florid style (a florid writer)FLORIDLY: in a florid manner: with floridity; very flowery in style: ornate (florid prose, florid declamations); also: having a florid style (a florid writer)GLOP: tasteless or worthless materialGLOPPY: tasteless or worthless materialGRAND: lofty, sublime (writing in the grand style)GRAPHIC: marked by clear lifelike or vividly realistic description; also, vividly or plainly shown or described, or using offensive or obscene words: including swear wordsGRITTY: having strong qualities of tough uncompromising realismHAMARTIA: the tragic flaw: a flaw in character that brings about the downfall of the hero of a tragedyHARMONY: an interweaving of different accounts into a single narrative, or a systematic arrangement of parallel literary passages (as of the Gospels) for the purpose of showing agreement or harmonyHIGH: marked by sublime, heroic, or stirring events or subject matter (high tragedy) (a tale of high adventure)IDIOM: an expression in the usage of a language that is peculiar to itself either in having a meaning that cannot be derived from the conjoined meanings of its elements (such as up in the air for "undecided") or in its grammatically atypical use of words (such as give way)IDIOMATIC: an expression in the usage of a language that is peculiar to itself either in having a meaning that cannot be derived from the conjoined meanings of its elements (such as up in the air for "undecided") or in its grammatically atypical use of words (such as give way)IMBROGLIO: an intricate or complicated situation (as in a drama or novel)IMITATION: a literary work designed to reproduce the style of another authorIRONIC: relating to, containing, or constituting irony; given to ironyIRONY: a usually humorous or sardonic literary style or form characterized by irony; an ironic expression or utteranceJAPE: an amusing literary or dramatic productionJUVENILE: of literature: of, relating to, characteristic of, or suitable for children or young people (e.g., juvenile fiction); also, a book for children or young peopleLEITMOTIF: a dominant recurring themeLEMMA: the argument or theme of a composition prefixed as a title or introduction; also: the heading or theme of a comment or note on a text; also, a glossed word or phraseLIGHT: intended chiefly to entertain (light verse, light comedy)LIMN: to describeLIMNED: to describeLIMNING: to describeLIMPID: clear and simple in style (limpid prose)MACHINE: a literary device or contrivance (such as a supernatural being or event) introduced for dramatic effectMANDARIN: adjective: marked by polished ornate complexity of language (mandarin prose)MONTAGE: a literary, musical, or artistic composite of juxtaposed more or less heterogeneous elements; also, to combine into or depict in a montageMOOD: the expression of mood especially in art or literatureMOODY: expressive of a moodMORAL: the moral significance or practical lesson (as of a story); a passage pointing out usually in conclusion the lesson to be drawn from a storyMOTIF: a usually recurring salient thematic element (as in the arts), especially: a dominant idea or central themeMOTIVE: a motif: a usually recurring salient thematic element (as in the arts), especially: a dominant idea or central themeNARRATION: the act or process or an instance of narrating; a story, narrativeNARRATOR: one who narrates, to tell (a story) in detailNOIR: (adj.): having a bleak and darkly cynical quality of the kind associated with hard-boiled crime fiction and film noirNONFICTION: writing or cinema that is about facts and real eventsPACE: rhythmic animation: fluency (writes with color, with zest, and with pace —Amy Loveman)PAGAN: (literary): one who has little or no religion and who delights in sensual pleasures and material goods: a nonreligious hedonistic person; also, (adj.): of, relating to, or having the characteristics of pagansPHILOLOGY: the study of literature and of disciplines relevant to literature or to language as used in literature; also, linguistics, especially: historical and comparative linguistics; also, the study of human speech especially as the vehicle of literature and as a field of study that sheds light on cultural historyPIECE: a literary, journalistic, artistic, dramatic, or musical compositionPLOT: the plan or main story (as of a movie or literary work); also, to invent or devise the plot of (something, such as a movie or a literary work)PLOTTING: the plan or main story (as of a movie or literary work); also, to invent or devise the plot of (something, such as a movie or a literary work)PULP: a magazine or book printed on cheap paper (such as newsprint) and often dealing with sensational material; also: sensational or tabloid writing —often used attributively (pulp fiction)PULPY: relating to, suggestive of, or characterized by the sensational subject matter or tone of pulp fictionRHYTHM: the repetition in a literary work of phrase, incident, character type, or symbol; also, the effect created by the elements in a play, movie, or novel that relate to the temporal development of the actionRHYTHMIC: the repetition in a literary work of phrase, incident, character type, or symbol; also, the effect created by the elements in a play, movie, or novel that relate to the temporal development of the actionRIFF: a distinct variation: a take (a surprising riff on the traditional fairy tale); also, to perform, deliver, or make use of a riffRIFFING: a distinct variation: a take (a surprising riff on the traditional fairy tale); also, to perform, deliver, or make use of a riffROMP: a light fast-paced narrative, dramatic, or musical work usually in a comic moodROUND: presented with lifelike fullness or vividness (The author creates a round character, full of faults and virtues.)TAUT: marked by economy of structure and detail (a taut story)TAUTLY: marked by economy of structure and detail (a taut story)TEXT: theme, topicTHEMA*: a topic or subject of discourse or of a written dissertation: thesisTHEMATIC: of, relating to, or constituting a themeTHEME: a subject or topic of discourse or of artistic representation; a specific and distinctive quality, characteristic, or concern (The campaign has lacked a theme.)THEMED: a subject or topic of discourse or of artistic representation; a specific and distinctive quality, characteristic, or concern (The campaign has lacked a theme.)THEMING: not in M-W; Collins has to give a theme to; specif., to plan according to a central theme; to provide with a theme (a themed restaurant)TIGHT: of writing: marked by control or discipline in expression or style: having little or no extraneous matter (tight writing)TIGHTLY: of writing: marked by control or discipline in expression or style: having little or no extraneous matter (tight writing)TIMELINE: a branch of a theoretical multiverse that exists in parallel with other branches —used especially in science fictionTINKLE: a jingling effect in verse or proseTONE: style or manner of expression in speaking or writing (a conciliatory tone); also, to soften or reduce in intensity, color, appearance, or sound: to mellow —often used with downTONED: style or manner of expression in speaking or writing (a conciliatory tone); also, to soften or reduce in intensity, color, appearance, or sound: to mellow —often used with downTONING: style or manner of expression in speaking or writing (a conciliatory tone); also, to soften or reduce in intensity, color, appearance, or sound: to mellow —often used with downTRIPTYCH: something composed or presented in three parts or sections, especially: a trilogyTUMID: bombastic, turgid; excessively embellished in style or language; pompous (a tumid writing style)TURN: a fashioning of language or arrangement of words: manner of expression (skillful turns of phrase); also, a special twist, construction, or interpretation (gave the old yarn a new turn)TYPE: a person or thing (as in the Old Testament) believed to foreshadow another (as in the New Testament); to represent beforehand as a type: to prefigureTYPED: a person or thing (as in the Old Testament) believed to foreshadow another (as in the New Testament); to represent beforehand as a type: to prefigureTYPING: a person or thing (as in the Old Testament) believed to foreshadow another (as in the New Testament); to represent beforehand as a type: to prefigureUNIRONIC: not ironic; especially: not using or given to irony: sincereUNITY: a combination or ordering of parts in a literary or artistic production that constitutes a whole or promotes an undivided total effect; also: the resulting singleness of effect or symmetry and consistency of style and character; also, any of three principles of dramatic structure derived by French classicists from Aristotle's Poetics and requiring a play to have a single action represented as occurring in one place and within one dayVEIN: a distinctive mode of expression: style (stories in a romantic vein); a line of thought or action; a distinctive element or quality: strain (introduced a welcome vein of humor)VILLAIN: a character in a story or play who opposes the heroWORD: to express in words: to phraseWORDILY: using or containing many and usually too many words
WORDING: to express in words: to phraseWORDY: using or containing many and usually too many words
People in Writing and Publishing
ADAPTOR: M-W: less common variant of adapter, one that adaptsALLONYM*: a name that is assumed by an author but that actually belongs to another person, or a work published under the name of a person other than the authorANCIENT: one of the classical authors (e.g., Plutarch and other ancients)ANNOTATOR: one who annotates: to make or furnish critical or explanatory notes or comment; to make or furnish annotations for (something, such as a literary work or subject)AUTHOR: the writer of a literary work (such as a book)BARD: a tribal poet-singer skilled in composing and reciting verses on heroes and their deeds, or a composer, singer, or declaimer of epic or heroic verse; a poetBEAT: often capitalized: of, relating to, or being beatniks; beat poetsCANON: the authentic works of a writer, or the sanctioned or accepted group or body of related worksCOAUTHOR: one who collaborates with another person in authoring a literary or dramatic work, a document, a legislative bill, etc.HACK: a writer who works on order; also: a writer who aims solely for commercial success especially with mediocre professional standards (a hack journalist); performed by or suited to a person who works or writes purely for the purpose of earning money: characteristic of a hack: mediocre (hack writing); from Hackney, Middle English hakeney, hakenay "a small saddle horse, especially one for hire," probably from hackney, originally a parish and village, where nearby meadows may have been used to pasture horses; hackney = horse let out for hire anything let for hire mercenary or contract employee; combined with worn-out mediocre workerJOURNO: M-W’s only def.: chiefly British: a journalist, a person engaged in journalism, especially: a writer or editor for a news mediumLEGMAN*: a reporter assigned usually to gather informationLEGMEN*: a reporter assigned usually to gather informationPAPARAZZI: plural of paparazzo, a freelance photographer who aggressively pursues celebrities for the purpose of taking candid photographs, Italian, from Paparazzo, surname of such a photographer in the film La dolce vita (1959) by Federico FelliniPENMAN: an authorPENMEN: not in M-W, but in Collins: plural of penman, an authorPOET: one who writes poetry: a maker of verses
Poetry and Poetic Forms
ACCENT: a rhythmically significant stress on the syllables of a verse usually at regular intervalsBALLAD: a narrative composition in rhythmic verse suitable for singingBALLADRY: the composing or performing of balladsBEAT: a metrical or rhythmic stress in poetry or the rhythmic effect of these stressesCANTO*: one of the major divisions of a long poemCINQUAIN: a 5-line stanzaCOLA: plural of colon: a rhythmical unit of an utterance specifically, in Greek or Latin verse: a system or series of from two to not more than six feet having a principal accent and forming part of a lineCOLON: a rhythmical unit of an utterance specifically, in Greek or Latin verse: a system or series of from two to not more than six feet having a principal accent and forming part of a line (plural: cola)CONCEIT: an elaborate or strained metaphor (The poem abounds in metaphysical conceits.); also, the use or presence of such conceits in poetryCYCLE: a group of creative works (such as poems, plays, or songs) treating the same theme (a song cycle, a cycle of poems on nature); also, a series of narratives dealing typically with the exploits of a legendary hero (the Arthurian cycle)DACTYL: a metrical foot consisting of one long and two short syllables or of one stressed and two unstressed syllables (as in tenderly)DACTYLIC: a metrical foot consisting of one long and two short syllables or of one stressed and two unstressed syllables (as in tenderly)DIVAN: a collection of poems in Persian or Arabic usually by one authorDUPLE: of rhythm: consisting of a meter based on disyllabic feetELEGIAC: of, relating to, or consisting of two dactylic hexameter lines the second of which lacks the arsis in the third and sixth feet; or written in or consisting of elegiac couplets; or, of or relating to the period in Greece about the seventh century B.C. when poetry written in such couplets flourishedELEGIZE: to write an elegyELEGIZED: to write an elegyELEGIZING: to write an elegyELEGY: a poem in elegiac couplets; or a song or poem expressing sorrow or lamentation especially for one who is dead; or something (such as a speech) resembling such a song or poem; or a pensive or reflective poem that is usually nostalgic or melancholy ENCODE: to convey symbolically (e.g., the capacity of poetry to encode ideology)ENCODED: to convey symbolically (e.g., the capacity of poetry to encode ideology)ENJAMBMENT: the running over of a sentence from one verse or couplet into another so that closely related words fall in different linesEPIC: a long narrative poem in elevated style recounting the deeds of a legendary or historical heroEPODE: a lyric poem in which a long verse is followed by a shorter one; or the third part of a triadic Greek ode following the strophe and the antistropheFEET: plural of foot: the basic unit of verse meter consisting of any of various fixed combinations or groups of stressed and unstressed or long and short syllablesFEMALE: of a rhyme: feminine; having an unstressed final syllableFEMININE: poetry: being an unstressed and usually additional final syllable after the final complete foot in a line of verse; also, of rhyme: having an unstressed final syllableFOOT: the basic unit of verse meter consisting of any of various fixed combinations or groups of stressed and unstressed or long and short syllablesHYMN: a song of praise or joy; something resembling a song of praise: a paeanIAMB: a metrical foot consisting of one short syllable followed by one long syllable or of one unstressed syllable followed by one stressed syllable (as in above)IAMBI: M-W says that the plural of “iamb” is “iambs” (or “iambuses,” the plural of the alternate “iambus”). A metrical foot consisting of one short syllable followed by one long syllable or of one unstressed syllable followed by one stressed syllable (as in above)IAMBIC: of or relating to an iamb or iambsIDYL: M-W: less common variant of idyll, a simple descriptive work in poetry or prose that deals with rustic life or pastoral scenes or suggests a mood of peace and contentment; also, a narrative poem (such as Tennyson's Idylls of the King) treating an epic, romantic, or tragic themeIDYLL: M-W: or less commonly idyl, a simple descriptive work in poetry or prose that deals with rustic life or pastoral scenes or suggests a mood of peace and contentment; also, a narrative poem (such as Tennyson's Idylls of the King) treating an epic, romantic, or tragic themeILIAD*: M-W shows only the proper noun Iliad, a series of miseries or disastrous events; also, a series of exploits regarded as suitable for an epic; also, a long narrative, especially: an epic in the Homeric traditionJINGLING: a catchy repetition of sounds in a poem; also, a short verse or song marked by catchy repetition; also, to rhyme or sound in a catchy repetitious mannerJINGLY: a catchy repetition of sounds in a poem; also, a short verse or song marked by catchy repetition; also, to rhyme or sound in a catchy repetitious mannerLAMENT: a dirge, an elegyLINE: a unit in the rhythmic structure of verse formed by the grouping of a number of the smallest units of the rhythm (such as metrical feet) (The poem consisted of 14 lines.)LYRIC: a lyric composition, specifically: a lyric poem; also, expressing direct usually intense personal emotion especially in a manner suggestive of song (e.g., lyric poetry)MACRON: a mark − placed over a vowel to indicate that the vowel is long or placed over a syllable or used alone to indicate a stressed or long syllable in a metrical footMADE: to compose, write (make verses)MADRIGAL: a medieval short lyrical poem in a strict poetic formMAKE: to compose, write (make verses)MAKING: to compose, write (make verses)MALE: of rhyme: masculine, having a stressed final syllable (a male rhyme)OCTAVE: a stanza of eight lines: ottava rima; also, the first eight lines of an Italian sonnetOCTET: an octave, the first eight lines of an Italian sonnetODIC*: of, relating to, or forming an odePAEAN: a joyous song or hymn of praise, tribute, thanksgiving, or triumph; also, a work that praises or honors its subject: encomium, tribute; Latin, hymn of thanksgiving especially addressed to Apollo, from Greek paian, paiōn, from Paian, Paiōn, epithet of Apollo in the hymnPART: a division of a literary work (a novel in four parts, a poem in six parts)POEM: a composition in verse; also, something suggesting a poem (as in expressiveness, lyricism, or formal grace)POET: one who writes poetry: a maker of versesRUNIC: related to or characteristic of a rune or runes: a Finnish or Old Norse poem; or a poem or songTANKA: an unrhymed Japanese verse form of five lines containing five, seven, five, seven, and seven syllables respectively; also: a poem in this formTEXT: the words of something (such as a poem) set to musicTINKLE: a jingling effect in verse or proseTRAGIC: or less commonly tragical: dealing with or treated in tragedy, a medieval narrative poem or tale typically describing the downfall of a great manTRAGICAL: or less commonly tragical: dealing with or treated in tragedy, a medieval narrative poem or tale typically describing the downfall of a great manVILLANELLE: a chiefly French verse form running on two rhymes and consisting typically of five tercets and a quatrain in which the first and third lines of the opening tercet recur alternately at the end of the other tercets and together as the last two lines of the quatrain
Prose Genres and Forms
APOLOGY: something that is said or written to defend something that other people criticize: a defenseBAGATELLE: a short literary or musical piece in light styleBOOK: a long written or printed literary compositionBOOKS: a long written or printed literary compositionCODA: a concluding part of a literary or dramatic workCOMEDIC: of or relating to comedy, the genre of dramatic literature dealing with the comic or with the serious in a light or satirical manner; also, a medieval narrative that ends happily (Dante's Divine Comedy); also, a literary work written in a comic style or treating a comic theme (the ancient Roman comedies of Plautus)COMEDY: the genre of dramatic literature dealing with the comic or with the serious in a light or satirical manner; also, a medieval narrative that ends happily (Dante's Divine Comedy); also, a literary work written in a comic style or treating a comic theme (the ancient Roman comedies of Plautus)COMPANION: a book, manual, etc., that provides information or advice about a particular subject (a companion to French New Wave cinema) —used in titles (The Gardener's Companion)CONTE*: a usually short tale of adventureCRITICAL: consisting of or involving criticism (critical writings); also: of or relating to the judgment of critics (the play was a critical success.)CRITICALLY: consisting of or involving criticism (critical writings); also: of or relating to the judgment of critics (the play was a critical success.)CYCLE: a group of creative works (such as poems, plays, or songs) treating the same theme (a song cycle, a cycle of poems on nature); also, a series of narratives dealing typically with the exploits of a legendary hero (the Arthurian cycle)DIALOG: less common variant of dialogue: a written composition in which two or more characters are represented as conversingDRAMA: a composition in verse or prose intended to portray life or character or to tell a story usually involving conflicts and emotions through action and dialogue and typically designed for theatrical performance: a playEPIC: a work of art (such as a novel or drama) that resembles or suggests an epic; or a series of events or body of legend or tradition thought to form the proper subject of an epicEPILOG: epilogue: a concluding section that rounds out the design of a literary workEPITOME: a summary of a written work; a brief presentation or statement of something
ESSAY: an analytic or interpretative literary composition usually dealing with its subject from a limited or personal point of view; also, something resembling such a composition (a photographic essay)ESSAYS: an analytic or interpretative literary composition usually dealing with its subject from a limited or personal point of view; also, something resembling such a composition (a photographic essay)EXEMPLA*: plural of exemplum: an example or model; also, an anecdote or short narrative used to point a moral or sustain an argumentFABLE: a fictitious narrative or statement: such as a legendary story of supernatural happenings, or a narration intended to enforce a useful truth, especially: one in which animals speak and act like human beingsFABLED: fictitious; told or celebrated in fablesFABULOUS: resembling or suggesting a fable; told in or based on fableFANFIC: short for fan fiction, stories involving popular fictional characters that are written by fans and often posted on the InternetFICTION: fictitious literature (such as novels or short stories); also, a work of fictionespecially: a novelFICTIVE: having the characteristics of fiction: fictionalFOLKTALE: a characteristically anonymous, timeless, and placeless tale circulated orally among a peopleIDYL: M-W: less common variant of idyll, a simple descriptive work in poetry or prose that deals with rustic life or pastoral scenes or suggests a mood of peace and contentmentIDYLL: M-W: or less commonly idyl, a simple descriptive work in poetry or prose that deals with rustic life or pastoral scenes or suggests a mood of peace and contentmentILIAD*: M-W and NOAD capitalize Iliad, a series of miseries or disastrous events; also, a series of exploits regarded as suitable for an epic; also, a long narrative, especially: an epic in the Homeric traditionLEGEND: a story coming down from the past, especially: one popularly regarded as historical although not verifiable (the legend of a lost continent); also, a body of such stories (Arthurian legends); also, a popular myth of recent origin (the legend of the Loch Ness monster)MEMO: a usually brief written message or report; a memorandumMONOLOG: more commonly monologue: a literary composition written in the form of a soliloquyMONUMENT: a written tributeMYTH: a usually traditional story of ostensibly historical events that serves to unfold part of the world view of a people or explain a practice, belief, or natural phenomenon (a creation myth); also, a parable, or allegory; also, the whole body of myths (a student of Greek myth)MYTHIC: variant of mythical, based on or described in a myth especially as contrasted with historyMYTHOLOGY: an allegorical narrative; also, a body of myths: such as the myths dealing with the gods, demigods, and legendary heroes of a particular people; also, a branch of knowledge that deals with mythNOIR: crime fiction featuring hard-boiled cynical characters and bleak sleazy settingsNONFICTION: writing or cinema that is about facts and real eventsNOVEL: an invented prose narrative that is usually long and complex and deals especially with human experience through a usually connected sequence of events; also, the literary genre consisting of novelsNOVELETTE: a novella, a work of fiction intermediate in length and complexity between a short story and a novelNOVELLA: a story with a compact and pointed plotPARAGRAPHING: a subdivision of a written composition that consists of one or more sentences, deals with one point or gives the words of one speaker, and begins on a new usually indented line; also, a short composition or note that is complete in one paragraph; also, to divide into paragraphs; to write paragraphs about (to paragraph a topic); to write paragraphsPARAGRAPHING: a subdivision of a written composition that consists of one or more sentences, deals with one point or gives the words of one speaker, and begins on a new usually indented line; also, a short composition or note that is complete in one paragraph; also, to divide into paragraphs; to write paragraphs about (to paragraph a topic); to write paragraphsPART: a division of a literary work (a novel in four parts, a poem in six parts)PORTRAIT: a graphic portrayal in wordsPORTRAY: to describe in wordsPORTRAYAL: the act or process or an instance of portraying: a representation; also, a portraitTALE: a usually imaginative narrative of an event: a storyTHEME: a writing exercise especially for students: a composition (The students were assigned to write a theme on a person they admire.)TRAGIC: or less commonly tragical: dealing with or treated in tragedy (the tragic hero); appropriate to or typical of tragedy: a serious drama typically describing a conflict between the protagonist and a superior force (such as destiny) and having a sorrowful or disastrous conclusion that elicits pity or terror; also, the literary genre of tragic dramas; also, a medieval narrative poem or tale typically describing the downfall of a great manTRAGICAL: or less commonly tragical: dealing with or treated in tragedy (the tragic hero); appropriate to or typical of tragedy: a serious drama typically describing a conflict between the protagonist and a superior force (such as destiny) and having a sorrowful or disastrous conclusion that elicits pity or terror; also, the literary genre of tragic dramas; also, a medieval narrative poem or tale typically describing the downfall of a great manWEEPIE: a tearjerker: a story, song, play, film, or broadcast that moves or is intended to move its audience to tearsYARN: [from the idiom spin a yarn "to tell a tale"]: a narrative of adventures, especially: a tall tale (a roaring good yarn); also, to tell a yarn
Publishing: Design and Layout print and digital
AGATE: a size of type approximately 5¹/₂ point, or condensed information (such as advertisements or box scores) set especially in agate typeBLANK: devoid of covering or content; empty (a blank space)BLEED: to be printed so as to run off one or more edges of the page after trimming; also, the printed matter (such as an illustration) that bleeds; also: the part of a bleed trimmed offBLOCK: typesetting: to make (two or more lines of writing or type) flush at the left or at both left and rightBLOCKED: typesetting: to make (two or more lines of writing or type) flush at the left or at both left and rightBLOCKS: typesetting: to make (two or more lines of writing or type) flush at the left or at both left and rightBOLD: boldface; being or set in boldface (bold lettering)BULLET: a large dot placed in printed matter to call attention to a particular passageCALLOUT: an often bordered inset in a printed article or illustrationCOLUMN: a vertical arrangement of items printed or written on a pageCOPY: matter to be set especially for printing; text especially of an advertisementDUMMIED: publishing: to make a dummy; often used with up (“dummied up the front page”)FONT: an assortment or set of type or characters all of one style and sometimes one sizeFORMAT: the shape, size, and general makeup (as of something printed)HAND: a character ☞ used to direct particular attention (as to a note or paragraph); called also fist, indexHEADLINE: words set at the head of a passage or page to introduce or categorize; also, to provide with a headlineHEADLINED: words set at the head of a passage or page to introduce or categorize; also, to provide with a headlineIMPRINT: an identifying name (as of a publisher) placed conspicuously on a product; also: the name under which a publisher issues booksINDENT: to set (something, such as a line of a paragraph) in from the margin; to form an indentation; also, the blank space produced by indenting: also, a document or a section of a document that is indentedINDENTED: to set (something, such as a line of a paragraph) in from the margin; to form an indentationINDEX: a character ☞ used to direct attention to a note or paragraph (called also fist); also, a thumb index: a series of usually labeled notches cut in the fore edge of a book (such as a dictionary) to facilitate referenceINITIAL: a large letter beginning a text or a division or paragraphITALIC: of or relating to a type style with characters that slant upward to the right; of or relating to a style of slanted cursive handwriting developed in the 15th and 16th centuriesITALICIZE: to print in italics or underscore with a single lineLINAGE: or less commonly lineage: the number of lines of printed or written matterLINE: a horizontal row of written or printed characters (the last line on the page); also: a blank row in lieu of such charactersLINEAGE: less common spelling of linage: the number of lines of printed or written matterMARGIN: the part of a page or sheet outside the main body of printed or written matterORPHAN: a first line (as of a paragraph) separated from its related text and appearing at the bottom of a printed page or columnPARAGRAPH: a character (such as ¶) used to indicate the beginning of a paragraph and as a reference markPICA: 12-point type; also, a unit of about ¹/₆ inch used in measuring typographic material; also, a typewriter type providing 10 characters to the linear inch and six lines to the vertical inchPITCH: typography: a unit of width of type based on the number of times a letter can be set in a linear inchPRINT: printed letters: typeQUAD: a type-metal space that is one en or more in width; also, to fill out (something, such as a typeset line) with blank spaceQUADRAT: a quad, a type-metal space that is one en or more in widthTAIL: the blank space at the bottom of a pageTHIRTY: a sign of completion: end [of a manuscript] —usually written –30–TITTLE: a point or small sign used as a diacritical mark in writing or printingTYPO: an error (as of spelling) in typed or typeset material; short for typographical (error)WEIGHT: the degree of thickness of the strokes of a type characterWHITE: the area of a page unmarked by writing, printing, or illustration; also, unmarked by writing or printing (a writer trying to will the white space on the page away)WIDOW: a single usually short last line (as of a paragraph) separated from its related text and appearing at the top of a printed page or columnwidowWORD: a written or printed character or combination of characters representing a spoken word; any segment of written or printed discourse ordinarily appearing between spaces or between a space and a punctuation mark
Publishing: Print Production the physical item
BACK: the spine of a book; also, not current (back issues of a magazine)BAND: a cord or strip across the back of a book to which the sections are sewnBEVEL: the part of printing type extending from face to shoulderBIND: to apply the parts of the cover to (a book)BINDING: the cover and materials that hold a book together; also, to apply the parts of the cover to (a book)BLANKET: a rubber or plastic sheet on the cylinder in an offset press that transfers the image to the surface being printedBLEED: to be printed so as to run off one or more edges of the page after trimming; also, the printed matter (such as an illustration) that bleeds; also: the part of a bleed trimmed offBOARD: the stiff foundation piece for the side of a book coverBOOKWORK: the manufacture of books as distinct from newspaper or magazine printing or from job workBOUND: past tense and past participle of bind: to apply the parts of the cover to (a book)BOUND: of a book: secured to the covers by cords, tapes, or glue —often used in combination (leather-bound)COLLATE: to assemble in proper order, especially: to assemble in order for binding; or to verify the order of (printed sheets)COPY: one of a series of especially mechanical reproductions of an original impression; also: an individual example of such a reproductionDECKLE: noun: a frame around the edges of a mold used in making paper by handEDITION: the whole number of copies published at one timeELITE: a typewriter type providing 12 characters to the linear inchFLAP: a part of a book jacket that folds under the book's coverFOLDOUT: a folded leaf in a publication (such as a book) that is larger in some dimension than the pageFOLIO: a leaf especially of a manuscript or book; also, a book printed on folio pages, or a book of the largest size; also, the size of a piece of paper cut two from a sheetFORM: the printing type or other matter arranged and secured in a chase ready for printingFOXED: discolored with foxing (brownish spots on old paper)GALLEY: an oblong tray to hold especially a single column of set type, or a proof of typeset matter especially in a single column before being made into pagesGRAPHIC: of or relating to the art of printingGRID: a device in a photocomposer on which are located the characters to be exposed as the text is composedHARDBACK: a book bound in hard covers
HEADBAND: a narrow strip of cloth sewn or glued by hand to a book at the extreme ends of the spineINKBLOT: a blot of inkINKED: to put ink onINKING: to put ink onJOINT: the flexing part of a cover along either spine edge of a bookLEAD: a thin strip of metal used to separate lines of type in printing; also, to put space between the lines of (typeset matter)LEADED: a thin strip of metal used to separate lines of type in printing; also, to put space between the lines of (typeset matter)LEAF: a part of a book or folded sheet containing a page on each side; also, to turn over pages especially to browse or skim (leaf through a book); to turn over the pages ofLEAFED: a part of a book or folded sheet containing a page on each side; also, to turn over pages especially to browse or skim (leaf through a book); to turn over the pages ofLEAFING: a part of a book or folded sheet containing a page on each side; also, to turn over pages especially to browse or skim (leaf through a book); to turn over the pages ofLEAVE: to leaf: to turn over pages especially to browse or skimLINE: the unit of fineness of halftones expressed as the number of screen lines to the linear inchLIVE: not yet printed from or plated (live type); not yet typeset (live copy)METAL: printing type metal; also, matter set in metal typeMIMEO: a mimeographed publication; from mimeograph, a duplicator for making many copies that utilizes a stencil through which ink is pressed; also, a verb, to mimeograph; from Mimeograph, a trademarkNOTCH: a rounded indentation cut into the pages of a book on the edge opposite the spinePAGE: one of the leaves of a publication or manuscript; also: a single side of one of these leaves; also, the material printed or written on a page; also, to turn the pages (as of a book or magazine) especially in a steady or haphazard manner —usually used with through; also, to number or mark the pages ofPAGED: one of the leaves of a publication or manuscript; also: a single side of one of these leaves; also, the material printed or written on a page; also, to turn the pages (as of a book or magazine) especially in a steady or haphazard manner —usually used with through; also, to number or mark the pages ofPAGINAL: of, relating to, or referring to a page (as of a book); also, consisting of pages, especially: consisting of one page after anotherPAGINATING: to turn the pages (as of a book or magazine) especially in a steady or haphazard manner —usually used with through; also, to number or mark the pages ofPAGING: one of the leaves of a publication or manuscript; also: a single side of one of these leaves; also, the material printed or written on a page; also, to turn the pages (as of a book or magazine) especially in a steady or haphazard manner —usually used with through; also, to number or mark the pages ofPICA: 12-point type; also, a unit of about ¹/₆ inch used in measuring typographic material; also, a typewriter type providing 10 characters to the linear inch and six lines to the vertical inchPIED: past tense and past participle of pi: to spill or throw (type or type matter) into disorder, or to become pied (pi or pie is mixed type)PLATE: a prepared surface from which printing is done; also, to make a printing surface from or forPOINT: a unit of about ¹/₇₂ inch used especially to measure the size of typePRINT: the printing industry; also, to work as a printer; to publish in print; also, to make a copy of by impressing paper against an inked printing surface; also, to produce printed matter; to produce something in printed form; to print out: to make a printout (as by a computer)PROOF: a copy (as of typeset text) made for examination or correction; also, to proofread, to read and mark corrections in (something, such as a proof)PULL: a proof, a copy (as of typeset text) made for examination or correction; also, to print (something, such as a proof) by impressionRIBBON: a strip of inked fabric (as in a typewriter or printer)ROLL: a wheel for making decorative lines on book covers; also: a design impressed by such a toolROTARY: of, relating to, or being a press in which paper is printed by rotation in contact with a curved printing surface attached to a cylinderrotaryROTO*: rotogravure: photogravure, a process for printing from an intaglio plate prepared by photographic methods; also, a section of a newspaper devoted to rotogravure picturesRUNAROUND: matter typeset in shortened measure to run around something (such as a cut)RUNNING: to produce by or as if by printing —usually used with off (ran off 10,000 copies of the first edition)TEXT: a type suitable for printing running textTIPPED: to affix (an insert) in a book —often used with inTIPPING: to affix (an insert) in a book —often used with inTURN: a character or slug inverted in setting type; also, a piece of type placed bottom up; also, to invert (something, such as a character, rule, or slug) feet up and face down in setting typeTYPE: printed letters; also, a rectangular block usually of metal bearing a relief character from which an inked print can be made; also, a collection of such blocks (a font of type); also, alphanumeric characters for printing (The type for this book has been photoset.); also, a typeface (italic type); also, matter set in type (is the type ready for proofing?)TYPEFACE: all type of a single design; the face of printing typeUNBOUND: not bound: not having the leaves fastened together (an unbound book)UNCUT: of a book: not having the folds of the leaves slitUNLEADED: not having leads between the lines in printing; a lead is a thin strip of metal used to separate lines of type in printing; to lead is to put space between the lines of (typeset matter)
Publishing: Publication Elements content
ADDENDA: plural of addendum: a supplement to a book —often used in plural but singular in constructionANNEX: an added stipulation or statement: appendixAPPENDIX: supplementary material usually attached at the end of a piece of writingBLURB: a short publicity notice (as on a book jacket)BOOK: a major division of a treatise or literary workBOOKS: a major division of a treatise or literary workCHAP: short for chapterCODICIL: an appendix or supplementCOMMENT: a note explaining, illustrating, or criticizing the meaning of a writing (Comments on the passage were printed in the margin.)CONTENT: the topics or matter treated in a written work (table of contents)DEDICATE: to inscribe or address by way of compliment (dedicate a book to a friend)DEDICATED: to inscribe or address by way of compliment (dedicate a book to a friend)DEDICATEE: one to whom a thing is dedicatedENDNOTE: a note placed at the end of the textFOOTNOTE: a note of reference, explanation, or comment usually placed below the text on a printed pageFRONT: short for frontispiece, an illustration preceding and usually facing the title page of a book or magazineHEADPIECE: an ornament especially at the beginning of a chapter
INDEX: a list (as of bibliographical information or citations to a body of literature) arranged usually in alphabetical order of some specified datum (such as author, subject, or keyword): such as a list of items (such as topics or names) treated in a printed work that gives for each item the page number where it may be found; also, to create such an index, or to provide with an index, or to list in an index (all persons and places mentioned are carefully indexed), or to index something, or to serve as an index ofINDEXED: to create an index, or to provide with an index, or to list in an index (all persons and places mentioned are carefully indexed), or to index something, or to serve as an index ofINDEXING: to create an index, or to provide with an index, or to list in an index (all persons and places mentioned are carefully indexed), or to index something, or to serve as an index ofLEGEND: a caption, the explanatory comment or designation accompanying a pictorial illustrationNOTE: a printed comment or reference set apart from the textPLATE: a full-page illustration often on different paper from the text pagesTABLE: a condensed enumeration: a list (a table of contents)
TAILPIECE: an ornament placed below the text matter of a pageTEXT: the original words and form of a written or printed work; the main body of printed or written matter on a page; the principal part of a book exclusive of front and back matterTEXTUAL: of, relating to, or based on a textTITLE: the distinguishing name of a written, printed, or filmed production; also, a descriptive or general heading (as of a chapter in a book); also, having the same title as or providing the title for the collection or production of which it forms a part (the title song); also, to provide a title forTITLED: the distinguishing name of a written, printed, or filmed production; also, a descriptive or general heading (as of a chapter in a book); also, having the same title as or providing the title for the collection or production of which it forms a part (the title song); also, to provide a title forTITLING: the distinguishing name of a written, printed, or filmed production; also, a descriptive or general heading (as of a chapter in a book); also, having the same title as or providing the title for the collection or production of which it forms a part (the title song); also, to provide a title forTITULAR: of, relating to, or constituting a title (the titular hero of the play, book, etc.)TOPIC: a heading in an outlined argument or exposition
Publishing: Types of Publications
ALBUM: a collection usually in book form of literary selections, musical compositions, or pictures: an anthologyALMANAC: a usually annual publication containing statistical, tabular, and general information; also, a publication containing astronomical and meteorological data for a given year and often including a miscellany of other informationANNAL: M-W’s only def.: archaic for “annals,” especially: annals of a single year, locale, or people; back-formation from annalsANNUAL: a publication appearing yearlyBIBLE: a publication that is preeminent especially in authoritativeness or wide readership (always capitalized: the sacred scriptures of Christians comprising the Old Testament and the New Testament, or the sacred scriptures of some other religion [such as Judaism])BLOG: a website that contains online personal reflections, comments, and often hyperlinks, videos, and photographs provided by the writer; also: the contents of such a site; also, a regular feature appearing as part of an online publication that typically relates to a particular topic and consists of articles and personal commentary by one or more authors; also, to write or have a blog; to write or write about (something) on a blog (short for Weblog)BLOGGED: a website that contains online personal reflections, comments, and often hyperlinks, videos, and photographs provided by the writer; also: the contents of such a site; also, a regular feature appearing as part of an online publication that typically relates to a particular topic and consists of articles and personal commentary by one or more authors; also, to write or have a blog; to write or write about (something) on a blog (short for Weblog)BLOGGING: a website that contains online personal reflections, comments, and often hyperlinks, videos, and photographs provided by the writer; also: the contents of such a site; also, a regular feature appearing as part of an online publication that typically relates to a particular topic and consists of articles and personal commentary by one or more authors; also, to write or have a blog; to write or write about (something) on a blog (short for Weblog)BOOK: a set of written, printed, or blank sheets bound together between a front and back cover; also, a magazine, a print periodical containing miscellaneous pieces (such as articles, stories, poems) and often illustrated; also, an e-book, a book composed in or converted to digital format for display on a computer screen or handheld deviceBOOKS: a set of written, printed, or blank sheets bound together between a front and back cover; also, a magazine, a print periodical containing miscellaneous pieces (such as articles, stories, poems) and often illustrated; also, an e-book, a book composed in or converted to digital format for display on a computer screen or handheld device
BULL: abbreviation: bulletin: a periodical, especially: the organ of an institution or association; also, a brief public notice issuing usually from an authoritative source [e.g., a PSA; distinct from the sort of bulletin that is a newsletter or journal]BULLETIN: a periodical, especially: the organ of an institution or association; also, a brief public notice issuing usually from an authoritative source [e.g., a PSA; distinct from the sort of bulletin that is a newsletter or journal]CENTO*: a literary work made up of parts from other worksCOMIC: a comic strip or comic book; of or relating to comic stripsCOOKBOOK: a book of cooking directions and recipes; broadly: a book of detailed instructionsCOOKBOOKS: a book of cooking directions and recipes; broadly: a book of detailed instructionsDIARY: a record of events, transactions, or observations kept daily or at frequent intervals: a journal, especially: a daily record of personal activities, reflections, or feelings; or a book intended or used for a diaryDROP: informal: to be released to the public (The Spelling Bee drops at 3AM ET.)DROPPING: informal: to be released to the public (The Spelling Bee drops at 3AM ET.)FICHE: microfiche, a sheet of microfilm containing rows of images of printed pagesFLIPBOOK: M-W hyphenates flip-book: a series of illustrations of an animated scene bound together in sequence so that an illusion of movement can be imparted by flipping them rapidlyGARLAND: an anthology or collectionGEOLOGY: a treatise on geologyHANDBILL: a small printed sheet to be distributed (as for advertising) by handHANDBOOK: a book capable of being conveniently carried as a ready reference: a manual; also, concise reference book covering a particular subjectINDEX: a bibliographical analysis of groups of publications that is usually published periodically; also, a list of restricted or prohibited materialJOURNAL: a daily newspaper; also, a periodical dealing especially with matters of current interestLAWBOOK: a book containing or dealing with laws, legal subjects, or cases adjudicatedLEAFLET: a usually folded printed sheet intended for free distribution; also, to hand out leaflets; to hand out leaflets toLEXICON: a book containing an alphabetical arrangement of the words in a language and their definitions: a dictionaryLIBRARY: a series of related books issued by a publisher (a Dickens library); also, a collection of publications on the same subjectLIFE: a biography (a life of George Washington)MAGAZINE: a print periodical containing miscellaneous pieces (such as articles, stories, poems) and often illustrated; also: such a periodical published online; also, a section of a newspaper similar to a magazine, usually appearing on SundayMANGA: Japanese comic books and graphic novels considered collectively as a genre; also: an individual comic book or graphic novel of the manga genreMANUAL: a book that is conveniently handled, especially a handbookMICROCOPY: a photographic copy in which printed or other graphic matter is reduced in size (as on microfilm) ; also, to reproduce by means of a microcopy, or to make microcopiesMICROFILM: a film bearing a photographic record on a reduced scale of printed or other graphic matter; also, to reproduce on microfilm or to make microfilmsMICROFORM: a process for reproducing printed matter in a much reduced size (documents in microform); also, matter reproduced by microformMONTHLY: a monthly periodical publicationMONUMENT: a treatise, a systematic exposition or argument in writing including a methodical discussion of the facts and principles involved and conclusions reached; also, a written tributeNONPRINT*: not printed: not occurring in, being, or involving printed matter (citing nonprint sources; sales of the nonprint version of the book)NOTE: a scholarly or technical essay shorter than an article and restricted in scopeNUDIE: a publication that features photographs of nudes; featuring nudesOFFPRINT: a separately printed excerpt (such as a magazine article)OLIO: a miscellaneous collection (as of literary or musical selections)ORGAN: a periodical, especially one that represents an organization OUTLET: a medium of expression or publication; a publication or broadcast organization (media outlet)PANEL: a comic strip; also a frame of a comic strip (The comic strip was composed of four panels.)POCKETBOOK: often pocket book: a small especially paperback book that can be carried in the pocketPORN: informal: by shortening from pornography, the depiction of erotic behavior (as in pictures or writing) intended to cause sexual excitement; also, material (such as books or a photograph) that depicts erotic behavior and is intended to cause sexual excitement; also, the depiction of acts in a sensational manner so as to arouse a quick intense emotional reactionPRINT: printed matter; a printed state or form; a copy made by printing; also, prints plural: printed publications; a printout of, a printed record produced automatically (as by a computer)PROGRAM: a public notice; also, a brief usually printed outline of the order to be followed, of the features to be presented, and the persons participating (as in a public performance); also, to arrange or furnish a program of or for: billPULP: a magazine or book printed on cheap paper (such as newsprint) and often dealing with sensational material; also: sensational or tabloid writing —often used attributively (pulp fiction)PULPY: relating to, suggestive of, or characterized by the sensational subject matter or tone of pulp fictionROLL: a written document that may be rolled up: a scroll; specifically: a document containing an official or formal record (the rolls of parliament); also, a manuscript book; also, a list of names or related items: a catalogROTO*: rotogravure: photogravure, a process for printing from an intaglio plate prepared by photographic methods; also, a section of a newspaper devoted to rotogravure picturesSCHOOLBOOK: a school textbookSCHOOLBOOKS: a school textbookTEXT: a textbookTHROWAWAY: a free handbill or circularTITLE: a usually published work as distinguished from a particular copy (published 25 new titles)TOME: a book, especially a large or scholarly book; also, a volume forming part of a larger workTRACT: a pamphlet or leaflet of political or religious propaganda; also: a piece of writing that is suggestive of such a tractUNBOUND: not bound: not bound together with other issues (unbound periodicals)VANITY: (adjective): of, relating to, or being a work (such as a book or recording) whose production cost is paid by the author or artist; also, of, relating to, or being a showcase for a usually famous performer or artist who is often also the project's creator or driving force (write, direct, and star in a vanity film)VENUE: an outlet, a medium of expression or publicationWORKBOOK: a worker's manual; a booklet outlining a course of study; a student's book of problems to be solved directly on the pagesZINE: short for magazine (a print periodical containing miscellaneous pieces (such as articles, stories, poems) and often illustrated; also: such a periodical published online; also, a similar section of a newspaper usually appearing on Sunday; also, a radio or television program presenting usually several short segments on a variety of topics), especially: a noncommercial often homemade or online publication usually devoted to specialized and often unconventional subject matter
Writing and Editing process
ADAPT: to make fit (as for a new use) often by modification (adapt the curriculum to students' needs)ADAPTED: to make fit (as for a new use) often by modification (adapt the curriculum to students' needs)ADAPTING: to make fit (as for a new use) often by modification (adapt the curriculum to students' needs)ADAPTATION: something that is adapted (a new adaptation of an old recipe); specifically: a composition rewritten into a new form (a screen adaptation of a novel); also, the act or process of adapting (a process undergoing adaptation); the state of being adapted (adaptation to changing circumstances)ADAPTION*: adaptation: something that is adapted (a new adaptation of an old recipe); specifically: a composition rewritten into a new form (a screen adaptation of a novel); also, the act or process of adapting (a process undergoing adaptation); the state of being adapted (adaptation to changing circumstances)ADAPTIVITY: the quality of being adaptive: providing, contributing to, or marked by adaptation: arising as a result of adaptationADAPTOR: M-W: less common variant of adapter, one that adaptsANNOTATE: to make or furnish critical or explanatory notes or commentANNOTATING: to make or furnish critical or explanatory notes or commentANNOTATION: to make or furnish critical or explanatory notes or commentAPPEND: to add as a supplement or appendix (as in a book)APPENDED: to add as a supplement or appendix (as in a book)CANCEL: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCANCELABLE: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCANCELED: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCANCELING: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCANCELLABLE: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCANCELLED: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCANCELLING: to mark or strike out for deletion (cancel the offensive passage); also, a deleted part or passage, a leaf containing matter to be deleted, a new leaf or slip substituted for matter already printedCITABLE: to quote by way of example, authority, or proofCITATION: an act of quoting, especially: the citing of a previously settled case at law; an excerpt, quotationCITE: to quote by way of example, authority, or proofCITED: to quote by way of example, authority, or proofCITING: to quote by way of example, authority, or proofCLEAN: relatively free from error or blemish: clear; specifically: legible (a clean copy)COLLATE: to compare critically; to collect, compare carefully in order to verify, and often to integrate or arrange in orderCOMPILE: to compose out of materials from other documents, or to collect and edit into a volumeCORRUPT: to alter from the original or correct form or version (the file was corrupted); also, adulterated or debased by change from an original or correct condition (a corrupt version of the text)CRITICAL: including variant readings and scholarly emendations (a critical edition)CRITICALLY: including variant readings and scholarly emendations (a critical edition)DELETE: to eliminate especially by blotting out, cutting out, or erasingDELETED: to eliminate especially by blotting out, cutting out, or erasingDICTATE: to utter words to be transcribed: to give dictation; to speak or read for a person to transcribe or for a machine to recordDICTATED: to utter words to be transcribed: to give dictation; to speak or read for a person to transcribe or for a machine to recordDICTATING: to utter words to be transcribed: to give dictation; to speak or read for a person to transcribe or for a machine to recordDICTATION: the act or manner of uttering words to be transcribed; also, material that is dictated or transcribedDICTATOR: one who says or reads something for a person to transcribe or for a machine to record; one that dictates material that is dictated or transcribedDRAFT: a scheme, a design; a preliminary sketch, outline, or version (the author's first draft; a draft treaty); also, to compose, prepare (draft a memo); also, to draw the preliminary sketch, version, or plan of (draft the building plans, draft the budget legislation)DROP: to leave out in writing: to omit (accidentally dropped a whole line)DROPPING: to leave out in writing: to omit (accidentally dropped a whole line)EDIT: to prepare (something, such as literary material) for publication or public presentation (edit a manuscript); also, to delete —usually used with out; also, to alter, adapt, or refine especially to bring about conformity to a standard or to suit a particular purpose (carefully edited the speech; edit a data file); also, an instance or result of editingEDITED: to prepare (something, such as literary material) for publication or public presentation (edit a manuscript); also, to delete —usually used with out; also, to alter, adapt, or refine especially to bring about conformity to a standard or to suit a particular purpose (carefully edited the speech; edit a data file); also, an instance or result of editingEDITION: the form or version in which a text is published (a paperback edition, the German edition)EMEND: to correct usually by textual alterationsEMENDED: to correct usually by textual alterationsEMENDING: to correct usually by textual alterationsEXPAND: to express at length or in greater detail; to speak or write fully or in detail (expanded on the theme); to write out in full (expand all abbreviations)EXPANDED: to express at length or in greater detail; to speak or write fully or in detail (expanded on the theme); to write out in full (expand all abbreviations)EXPUNGE: to strike out, obliterate, or mark for deletionEXPUNGING: to strike out, obliterate, or mark for deletionFOLIO: a certain number of words taken as a unit or division in a document for purposes of measurement or referenceFOUL: containing marked-up corrections (a foul manuscript, foul proofs)PENNED: to write, to inditePENNING: to write, to inditePRINT: of, relating to, or writing for printed publicationsQUOTE: a quotation, something that is quoted, especially: a passage referred to, repeated, or adduced; also, to speak or write (a passage) from another usually with credit acknowledgment; to repeat a passage from especially in substantiation or illustration; also, to inform a hearer or reader that matter following is quoted; also, to borrow, to appropriate for one's own use (quoting the motifs of past artists); also, to cite in illustration (quote a similar case)QUOTED: a quotation, something that is quoted, especially: a passage referred to, repeated, or adduced; also, to speak or write (a passage) from another usually with credit acknowledgment; to repeat a passage from especially in substantiation or illustration; also, to inform a hearer or reader that matter following is quoted; also, to borrow, to appropriate for one's own use (quoting the motifs of past artists); also, to cite in illustration (quote a similar case)QUOTING: a quotation, something that is quoted, especially: a passage referred to, repeated, or adduced; also, to speak or write (a passage) from another usually with credit acknowledgment; to repeat a passage from especially in substantiation or illustration; also, to inform a hearer or reader that matter following is quoted; also, to borrow, to appropriate for one's own use (quoting the motifs of past artists); also, to cite in illustration (quote a similar case)RAWLY: raw: not being in polished, finished, or processed form (a raw draft of a thesis)TEXT: an edited or emended copy of an original work; also, a work containing such textTEXTUAL: of, relating to, or based on a textTYPE: to write with a computer keyboard or on a typewriter; also, to produce (a character, a document, etc.) using a keyboard (as on a computer); also: to keyboard, to enter (data, text, etc.) by means of a keyboardTYPED: to write with a computer keyboard or on a typewriter; also, to produce (a character, a document, etc.) using a keyboard (as on a computer); also: to keyboard, to enter (data, text, etc.) by means of a keyboardTYPING: to write with a computer keyboard or on a typewriter; also, to produce (a character, a document, etc.) using a keyboard (as on a computer); also: to keyboard, to enter (data, text, etc.) by means of a keyboardTYPO: an error (as of spelling) in typed or typeset material; short for typographical (error)UNEDITED: not edited: such as left unrevised; not yet edited (unedited books, unedited filmsUNKEMPT: rough, unpolished (unkempt prose)UNPENNED: unwrittenUNQUOTED: not quoted
Writing: Others
CHIT: a short letter or note, especially: a signed voucher of a small debt (as for food); or a small slip of paper with writing on itCORPORA: plural of corpus, all the writings or works of a particular kind or on a particular subject, especially: the complete works of an authorDIARY: a record of events, transactions, or observations kept daily or at frequent intervals: a journal, especially: a daily record of personal activities, reflections, or feelings; or a book intended or used for a diaryDROP: to write (drop us a line soon)DROPPING: to write (drop us a line soon)JOURNAL: a record of performance, events, or day-to-day activities; an account of day-to-day events; also, a record of experiences, ideas, or reflections kept regularly for private use: to diary; also, to keep such a recordLIFT: to plagiarize; to take out of normal setting (lift a word out of context)LIFTING: to plagiarize; to take out of normal setting (lift a word out of context)LINE: a short letter: a note (dropped him a line confirming the date)LOGBOOK: a record of performance, events, or day-to-day activitiesLOGGED: to make a note or record of: enter details of or about in a logLOGGING: to make a note or record of: enter details of or about in a logMARK: to make notations in or on; to make note of in writing: to jot (marking the date in his journal); a written or printed symbol (such as a comma or colon); also, a cross made in place of a signature; also, to indicate by a mark or symbol (mark an accent); also, to designate as if by a mark; to register, recordNICK: to jot down: to recordNICKED: to jot down: to recordNICKING: to jot down: to recordNOTATE: to put into notation, a note added by way of comment or explanationNOTATING: to put into notation, a note added by way of comment or explanationNOTATION: annotation, a note added by way of comment or explanation; also, a noteNOTATIONAL: annotation, a note added by way of comment or explanation; also, a noteNOTE: a memorandum; a condensed or informal record; a brief comment or explanation; a short informal letterNOTICE: a written or printed announcementNOTIFICATION: the act or an instance of notifying, giving formal notice to; also, a written or printed matter that gives noticeWRIT: something written: writing
Spelling Bee words related to
WRITING AND PUBLISHING
ACCENTACTIONADAPTADAPTATIONADAPTEDADAPTINGADAPTION*
ADAPTIVITYADAPTORADDENDAAGATEALBUMALLONYM*ALMANACANAPHORAANCIENTANGLEANGLEDANGLINGANNALANNEXANNOTATEANNOTATINGANNOTATIONANNOTATORANNUALANTICLIMACTICAPOLOGYAPPENDAPPENDEDAPPENDIXAUTHORAWKWARDAWKWARDLYBACKBACKHANDBAGATELLEBAGGYBALLADBALLADRYBANDBARDBEATBEVELBIBLEBINDBINDINGBLANKBLANKETBLEEDBLOCKBLOCKEDBLOCKSBLOGBLOGGEDBLOGGINGBLURBBOARDBODYBOLDBONEBOOKBOOKSBOOKWORKBOUND
BULLBULLETBULLETINCALLBACKCALLOUTCAMEOCANCELCANCELABLECANCELEDCANCELINGCANCELLABLECANCELLEDCANCELLINGCANONCANTO*CARRYCARRYINGCENTO*CHALKCHALKEDCHAPCHITCHOPPYCINQUAINCITABLECITATIONCITECITEDCITINGCLEANCLOTHECOAUTHORCODACODICILCOLACOLLATECOLONCOLORCOLOUR*COLUMNCOMEDICCOMEDYCOMICCOMMENTCOMPANIONCOMPILECONCEITCONCEPTCONTE*CONTENTCOOKBOOKCOOKBOOKSCOPYCORPORACORRUPTCOUCHCOUCHEDCOUCHINGCRAYONCRITICALCRITICALLYCYCLECYCLEDACTYLDACTYLICDAILYDECENCYDECKLEDEDICATEDEDICATEDDEDICATEEDELETEDELETEDDENOUEMENTDEPICTDEPICTEDDEVICEDIALOGDIARYDICTATEDICTATEDDICTATINGDICTATIONDICTATORDIVANDRAFTDRAMADRAMATICDROPDROPPINGDRYLYDUMMIEDDUPLEEDGEEDITEDITEDEDITIONELEGIACELEGIZEELEGIZEDELEGIZINGELEGYELITEELLIPTIC
ELLIPTICALEMBEDEMBEDDEDEMENDEMENDEDEMENDINGENCODEENCODEDENDNOTEENJAMBMENTEPICEPILOGEPITOMEEPODE
ESSAYESSAYSEXEMPLA*EXPANDEXPANDEDEXPLICITEXPUNGEEXPUNGINGFABLEFABLEDFABULOUSFANFICFEETFEMALEFEMININEFICHEFICTIONFICTIVEFLAPFLIPBOOK
FLORIDFLORIDLYFOLDOUTFOLIOFOLKTALEFONTFOOTFOOTNOTEFORMFORMATFOULFOXEDFRONTGAGGLEGALLEYGARLANDGEOLOGYGLOPGLOPPYGONZOGRANDGRAPHICGRIDGRITTYHACKHAMARTIAHANDHANDBILLHANDBOOKHARDBACKHARMONY
HEADBANDHEADLINEHEADLINEDHEADPIECEHIGHHYMNIAMBIAMBIIAMBICIDIOMIDIOMATICIDYLIDYLLILIAD*ILLEGIBILITYILLEGIBLEILLEGIBLYIMBROGLIOIMITATIONIMPRINTINDENTINDENTEDINDEXINDEXED
INDEXINGINITIALINITIALINGINKBLOTINKEDINKINGINKWELLIRONICIRONYITALICITALICIZE
JAPEJINGLINGJINGLYJOINTJOTTEDJOURNALJOURNOJUVENILEKILLKILLEDKILLINGLAMENTLAPBOARDLAWBOOKLEADLEADEDLEAFLEAFEDLEAFINGLEAFLETLEAVELEDELEGENDLEGIBILITYLEGIBLELEGIBLYLEGMAN*LEGMEN*LEITMOTIFLEMMALEXICONLIBRARYLIFELIFTLIFTINGLIGHTLIMNLIMNEDLIMNINGLIMPIDLINAGELINELINEAGELIVELOGBOOKLOGGEDLOGGINGLONGHANDLYRICMACHINEMACRONMADEMADRIGALMAGAZINEMAKEMAKINGMALEMANDARINMANGAMANUALMARGINMARKMARKMEDIAMEDIUMMEMOMETALMICROCOPYMICROFILMMICROFORMMIMEOMONOLOGMONTAGEMONTHLYMONUMENTMOODMOODYMORALMOTIFMOTIVEMYTHMYTHICMYTHOLOGYNARRATIONNARRATORNICKNICKEDNICKINGNOIRNONFICTIONNONPRINT*NOTATENOTATINGNOTATIONNOTATIONALNOTCHNOTENOTICENOTICINGNOTIFICATIONNOVELNOVELETTENOVELLANUDIEOBITOCTAVEOCTETODIC*OFFPRINTOLIOORGANORPHANOUTLETPACEPAEANPAGANPAGEPAGEDPAGINALPAGINATINGPAGINGPANELPAPARAZZIPAPYRIPARAGRAPHPARAGRAPHINGPARTPARTPENCILPENCILEDPENMANPENMENPENNEDPENNINGPHILOLOGYPICAPIECEPIEDPITCHPLATEPLOTPLOTTINGPOCKETBOOKPOEMPOETPOINTPOOLPORNPORTRAITPORTRAYPORTRAYALPOTHOOKPRINTPROGRAMPROOFPROTRACTORPULLPULPPULPYQUADQUADRATQUILLQUOTEQUOTEDQUOTINGRAWLYRHYTHMRHYTHMICRIBBONRIFFRIFFINGROLLROMPROTARYROTO*ROUNDRUNAROUNDRUNICRUNNINGSCHOOLBOOKSCHOOLBOOKSTABLETABLETTAIL
TAILPIECETAKETAKENTALETANKATAUTTAUTLYTEXTTEXTUALTHEMA*THEMATICTHEMETHEMEDTHEMINGTHIRTYTHROWAWAYTIGHTTIGHTLYTIMELINETINKLETIPPEDTIPPINGTITLETITLEDTITLINGTITTLETITULARTOMETONETONEDTONINGTOOKTOPICTRACTTRAGICTRAGICALTRIPTYCHTUMIDTURNTYPETYPEDTYPEFACETYPINGTYPOUNBOUNDUNCUTUNEDITEDUNIRONICUNITYUNKEMPTUNLEADEDUNPENNEDUNQUOTEDVANITYVEINVELLUMVENUEVILLAINVILLANELLEWEDGEWEEPIEWEIGHTWHITEWIDOWWORDWORDILY
WORDINGWORDYWORKBOOKWRITYARNZINE