LexiTopic: Energy, Light, Sound and Heat
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to ENERGY, LIGHT, SOUND, HEAT in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to ENERGY, LIGHT, SOUND, HEAT
SUBJECT HEADINGS IN THIS LEXITOPIC:
ColdDarknessEnergy Production, Storage, TransferFireFuels other than woodHeatHeating and Heating EquipmentIllumination and Lighting EquipmentLightOptics and Optical EquipmentSilence and QuietSounds and Noises not hearing, not recordings
NOTES ABOUT THE TAXONOMY FOR ENERGY AND LIGHTING
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to energy and manifestations of energy (sound, light, heat, etc.).
Words related to wood, including those used as fuels, are in Lumber and Lumbering Products within MANUFACTURING, PRODUCTS, AND PACKAGING.
Words related to outdoor temperature are in WEATHER AND CLIMATE.
Words related to hearing, vision, and other senses are in HUMAN HEALTH AND MEDICINE. Words related to the things heard are here in ENERGY, LIGHT, SOUND, HEAT. Words related to things seen and unseen are in PLACES AND SPACES.
Words related to sound recordings are in INFORMATION AND COMMUNICATION TECHNOLOGIES.
Words related to human speech sounds are in SPEECH AND VERBAL EXPRESSION; words related to animal and bird sounds are in ANIMALS; words related to musical sounds are in MUSIC.
Topical arrangement of Spelling Bee words related to ENERGY, LIGHT, SOUND, HEAT
Cold
ALGID*: coldARCTIC: bitter cold: frigidCHILL: a sensation of cold accompanied by shivering (as due to illness); a disagreeable sensation of coldness; a moderate but disagreeable degree of cold; moderately cold; cold, raw; affected by cold; also, to become cold; to shiver or quake with or as if with cold; to become taken with a chill; to make cold or chilly (chilled by a cold wind); to make cool especially without freezing (chill the wine)CHILLED: a sensation of cold accompanied by shivering (as due to illness); a disagreeable sensation of coldness; a moderate but disagreeable degree of cold; moderately cold; cold, raw; affected by cold; also, to become cold; to shiver or quake with or as if with cold; to become taken with a chill; to make cold or chilly (chilled by a cold wind); to make cool especially without freezing (chill the wine)CHILLING: a sensation of cold accompanied by shivering (as due to illness); a disagreeable sensation of coldness; a moderate but disagreeable degree of cold; moderately cold; cold, raw; affected by cold; also, to become cold; to shiver or quake with or as if with cold; to become taken with a chill; to make cold or chilly (chilled by a cold wind); to make cool especially without freezing (chill the wine)CHILLY: noticeably cold: chilling; unpleasantly affected by coldCOLD: a condition of low temperature (extremes of heat and cold) especially: cold weather (He waited outside for her in the bitter cold.); also, having or being a temperature that is uncomfortably low for humans; having a relatively low temperature or one lower than normal or expected; not heated; also, bodily sensation produced by loss or lack of heat (they died of the cold); marked by the loss of normal body heat (cold hands)COLDLY: a condition of low temperature (extremes of heat and cold) especially: cold weather (He waited outside for her in the bitter cold.); also, having or being a temperature that is uncomfortably low for humans; having a relatively low temperature or one lower than normal or expected; not heated; also, bodily sensation produced by loss or lack of heat (they died of the cold); marked by the loss of normal body heat (cold hands)COOL: moderately cold: lacking in warmth; facilitating or suggesting relief from heat (a cool dress, a cool climate); a cool time, place, or situation (the cool of the evening); to become cool: lose heat or warmth —sometimes used with off or down; to make cool: impart a feeling of coolness to (cooled the room with a fan) —often used with off or down (A swim cooled us off a little.)COOLANT: a usually fluid cooling agentCOOLED: moderately cold: lacking in warmth; facilitating or suggesting relief from heat (a cool dress, a cool climate); a cool time, place, or situation (the cool of the evening); to become cool: lose heat or warmth —sometimes used with off or down; to make cool: impart a feeling of coolness to (cooled the room with a fan) —often used with off or down (A swim cooled us off a little.)COOLING: moderately cold: lacking in warmth; facilitating or suggesting relief from heat (a cool dress, a cool climate); a cool time, place, or situation (the cool of the evening); to become cool: lose heat or warmth —sometimes used with off or down; to make cool: impart a feeling of coolness to (cooled the room with a fan) —often used with off or down (A swim cooled us off a little.)COOLLY: moderately cold: lacking in warmthCRYONIC: plural in form but usually singular in construction: the practice of freezing a person who has died of a disease in hopes of restoring life at some future time when a cure for the disease has been developedGELID: extremely cold: icyGLACIAL: suggestive of ice: extremely cold: frigidGLACIALLY: suggestive of ice: extremely cold: frigidICED: containing ice or cooled by ice or refrigerationICILY: intensely cold; characterized by coldness: frigidKEEL: chiefly dialectal: to cool, to become cool: lose heat or warmthKEELED: chiefly dialectal: to cool, to become cool: lose heat or warmthNIPPED: to injure or make numb with cold: to chill; to harm or numb someone or something with coldNIPPING: to injure or make numb with cold: to chill; to harm or numb someone or something with coldNIPPY: chillyPARCH: to dry or shrivel with coldTEMP: short for temperature: degree of hotness or coldness measured on a definite scaleUNHEATED: not heated (a small unheated shed, unheated leftovers)
Darkness
BEDIM: to make less bright; to make indistinct: obscureBEDIMMED: to make less bright; to make indistinct: obscureBLACK: total or nearly total absence of light (the black of night); characterized by the absence of light (a black night); reflecting or transmitting little or no light (black water)BLIND: something to keep out light; also, to withhold light fromBLINDING: to withhold light fromDARK: the absence of light: darkness; also, devoid or partially devoid of light: not receiving, reflecting, transmitting, or radiating light (a dark room); transmitting only a portion of light (dark glasses); also, to make darkDARKLY: the absence of light: darkness; also, devoid or partially devoid of light: not receiving, reflecting, transmitting, or radiating light (a dark room); transmitting only a portion of light (dark glasses); also, to make darkDEADEN: to deprive of brillianceDEADENED: to deprive of brillianceDEADENING: to deprive of brillianceDIMMED: to reduce the light from; to make dim or lusterlessDIMMING: to reduce the light from; to make dim or lusterlessFAINT: hardly perceptible: dimFAINTLY: hardly perceptible: dimGLOOM: partial or total darkness; also, a dark or shadowy place; also, to make dark, murky, or somber: to make gloomy; to loom up dimlyGLOOMILY: partially or totally dark; especially: dismally and depressingly dark (gloomy weather)GLOOMING: partial or total darkness; also, a dark or shadowy place; also, to make dark, murky, or somber: to make gloomy; to loom up dimlyGLOOMY: partially or totally dark; especially: dismally and depressingly dark (gloomy weather)NIGHT: the beginning of darkness: nightfall (worked in the fields until night); the quality or state of being dark (under cover of night)PALE: not bright or brilliant: dim (a pale sun shining through the fog); also, to become pale or to make palePALED: not bright or brilliant: dim (a pale sun shining through the fog); also, to become pale or to make palePALING: not bright or brilliant: dim (a pale sun shining through the fog); also, to become pale or to make paleTWILIGHT: the light from the sky between full night and sunrise or between sunset and full night produced by diffusion of sunlight through the atmosphere and its dust; especially: such light immediately following sunset; also, a time of twilightTWILIT: lighted by or as if by twilight; from twilight + litUMBRA: a conical shadow excluding all light from a given source; also, a shaded areaUNDIMMED: not made dim or dimmer: not dimmedUNLIT: not lighted: such as not illuminated with light (unlit roads, an unlit stairway)WANE: to become less brilliant or powerful: to dimWANED: to become less brilliant or powerful: to dimWANING: to become less brilliant or powerful: to dimWINK: to stop shining —usually used with out (the candle guttered and winked out)WINKING: to stop shining —usually used with out (the candle guttered and winked out)WRAITH: an insubstantial form or semblance: a shadow
Energy Production, Storage, Transfer
CAPACITANCE: the property of an electric nonconductor that permits the storage of energy as a result of the separation of charge that occurs when opposite surfaces of the nonconductor are maintained at a difference of potential; also, the measure of this property that is equal to the ratio of the charge on either surface to the potential difference between the surfaces; also, a part of a circuit or network that possesses capacitanceCAPACITOR: a device that is used to store electrical energyCAPACITY: capacitance: the quantity of electricity that a battery can deliver under specified conditionsCELL: a receptacle containing electrodes and an electrolyte either for generating electricity by chemical action or for use in electrolysis; also, a fuel cell; also, a single unit in a device for converting radiant energy into electrical energy or for varying the intensity of an electrical current in accordance with radiationCELL: a receptacle containing electrodes and an electrolyte either for generating electricity by chemical action or for use in electrolysis; also, a fuel cell; also, a single unit in a device for converting radiant energy into electrical energy or for varying the intensity of an electrical current in accordance with radiationCHARGING: to give an electric charge to; to restore the active materials in (a storage battery) by the passage of a direct current through in the opposite direction to that of discharge; of a battery or battery-powered device: to gain an electric charge: to receive and store a greater quantity of electrical energyCHARGING: to give an electric charge to; to restore the active materials in (a storage battery) by the passage of a direct current through in the opposite direction to that of discharge; of a battery or battery-powered device: to gain an electric charge: to receive and store a greater quantity of electrical energyCONDUCT: to have the quality of transmitting light, heat, sound, or electricity; also, to act as a medium for conveying or transmitting (metals conduct electricity well)CONDUCTED: to have the quality of transmitting light, heat, sound, or electricity; also, to act as a medium for conveying or transmitting (metals conduct electricity well)CONDUCTION: conductivity: the quality or power of conducting or transmitting: such as the reciprocal of electrical resistivity; also, transmission through or by means of a conductor; also: the transfer of heat through matter by communication of kinetic energy from particle to particle with no net displacement of the particlesCONVECT: to transfer heat by convectionCONVECTION: the transfer of heat by convectionCONVECTIVE: characterized by the transfer of heat by convectionCORKBOARD: a heat-insulating material made of compressed granulated corkENGINE: a machine for converting any of various forms of energy into mechanical force and motion; also: a mechanism or object that serves as an energy sourceFLOW: a continuous transfer of energyFRACK: the injection of fluid into shale beds at high pressure in order to free up petroleum resources (such as oil or natural gas). Short for (hydraulic) fracturingGIGAWATT: a unit of power equal to one billion watts (from James Watt †1819)HYDRO: shortened form of hydroelectric powerINPUT: power or energy put into a machine or system for storage, conversion in kind, or conversion of characteristics usually with the intent of sizable recovery in the form of output; also, the means by which or the point at which an input (as of energy, material, or data) is made; also, a component of production (such as land, labor, or raw materials)LIVE: exerting force or containing energyLOAD: power output (as of a power plant) or power consumption (as by a device); also, a device to which power is delivered; also, the demand on the operating resources of a system (such as a telephone exchange or a refrigerating apparatus)MACHINE: an assemblage of parts that transmit forces, motion, and energy one to another in a predetermined manner; also, an instrument (such as a lever) designed to transmit or modify the application of power, force, or motionNONCONDUCTOR: a substance that conducts heat, electricity, or sound only in very small degreeNONCONDUCTOR: a substance that conducts heat, electricity, or sound only in very small degreeNUKE: a nuclear-powered electric generating stationOUTPUT: power or energy produced or delivered by a machine or system (as for storage or for conversion in kind or in characteristics) (generator output, solar X-ray output)PHOTOCELL: short for photoelectric cell, an electronic device whose electrical properties are modified by the action of lightPILE: a reactor: a device for the controlled release of nuclear energy (as for producing heat)PLANT: a power plantPLATE: a metallic grid with its interstices filled with active material that forms one of the structural units of a batteryQUAD: a unit of energy equal to one quadrillion British thermal unitsQUANTA: plural of quantum, any of the very small increments or parcels into which many forms of energy are subdivided, or any of the small subdivisions of a quantized physical magnitude (such as magnetic moment)RADIATOR: any of various devices (such as a series of pipes or tubes) for transferring heat from a fluid within to an area or object outsideRADIO: of, relating to, or operated by radiant energyWATT: the absolute meter-kilogram-second unit of power equal to the work done at the rate of one joule per second or to the power produced by a current of one ampere across a potential difference of one volt : 1/746 horsepower, named for Scottish inventor, engineer and chemist James Watt †1819WAVE: a disturbance or variation that transfers energy progressively from point to point in a medium and that may take the form of an elastic deformation or of a variation of pressure, electric or magnetic intensity, electric potential, or temperature; also, one complete cycle of such a disturbanceWORK: energy expended by natural phenomena; also, the result of such energy (sand dunes are the work of sea and wind)WORK: physics: the transference of energy that is produced by the movement of the point of application of a force and is measured by multiplying the magnitude of the force by the amount of displacement of its point of application along the line of movement
Fire
ABLAZE: being on fireAFLAME: afire: being on fire: blazingBACKLOG: a large log at the back of a hearth fireBANK: to restrict the flow of air to (a fire) especially by piling ash around or over the burning embersBILLET: a chunky piece of wood (as for firewood)BLAZE: an intensely burning fire; an active burning, especially: a sudden bursting forth of flame; also, to burn brightly (the sun blazed overhead); to flare up: to flameBLAZING: an intensely burning fire; an active burning, especially: a sudden bursting forth of flame; also, to burn brightly (the sun blazed overhead); to flare up: to flame; also, blazing, (adj.) burning very brightly and intensely (a blazing fire)BURN: an act, process, instance, or result of burning; also, the injury or damage resulting from exposure to fire, heat, caustics, electricity, or certain radiations; also, a burned area (a burn on the tabletop); also, to consume fuel and give off heat, light, and gases; to undergo combustion; to undergo alteration or destruction by the action of fire or heat (the house burned down); to cause (something) to undergo combustion, especially: to destroy (something) by fire (they burned all his letters.); to transform (something) by exposure to heat or fire (burn wood into charcoal); to produce (something) by burning (burned a hole in his sleeve); to contain a fire (a little stove burning in the corner); to injure or damage (something or someone) by or as if by exposure to fire, heat, or radiation: to scorch (burned her hand); BURNING: an act, process, instance, or result of burning; also, the injury or damage resulting from exposure to fire, heat, caustics, electricity, or certain radiations; also, a burned area (a burn on the tabletop); also, to consume fuel and give off heat, light, and gases; to undergo combustion; to undergo alteration or destruction by the action of fire or heat (the house burned down); to cause (something) to undergo combustion, especially: to destroy (something) by fire (they burned all his letters.); to transform (something) by exposure to heat or fire (burn wood into charcoal); to produce (something) by burning (burned a hole in his sleeve); to contain a fire (a little stove burning in the corner); to injure or damage (something or someone) by or as if by exposure to fire, heat, or radiation: to scorch (burned her hand); BURNT: an act, process, instance, or result of burning; also, the injury or damage resulting from exposure to fire, heat, caustics, electricity, or certain radiations; also, a burned area (a burn on the tabletop); also, to consume fuel and give off heat, light, and gases; to undergo combustion; to undergo alteration or destruction by the action of fire or heat (the house burned down); to cause (something) to undergo combustion, especially: to destroy (something) by fire (they burned all his letters.); to transform (something) by exposure to heat or fire (burn wood into charcoal); to produce (something) by burning (burned a hole in his sleeve); to contain a fire (a little stove burning in the corner); to injure or damage (something or someone) by or as if by exposure to fire, heat, or radiation: to scorch (burned her hand); CATCH: to catch fireCHAR: to burn, or to convert to charcoal or carbon usually by heat; shortened from charcoalCHARRING: to burn, or to convert to charcoal or carbon usually by heat; shortened from charcoalCOAL: a glowing emberDEAD: grown cold: extinguished (The fire was dead; dead coals)FLAME: the glowing gaseous part of a fire, or a state of blazing combustion, or a condition or appearance suggesting a flame or burning; also, to burn with a flame : blaze —often used with up (Grease left heating in the pan flamed up suddenly.); also, to send or convey by means of flame (flame a message by signal fires); also, to treat or affect with flame: such as to sear, sterilize, or destroy by fireFLINT: a material used for producing a spark, especially: an alloy (as of iron and cerium) used in lightersFUMED: to give off in fumes (fuming thick black smoke); to expose to or treat with fumes; to emit fumes; to rise in or as if in fumesIGNITE: to set afire; kindle; to cause (a fuel) to burnIGNITING: to set afire; kindle; to cause (a fuel) to burnIGNITION: to set afire; kindle; to cause (a fuel) to burn; the process or means (such as an electric spark) of igniting a fuel mixture; the act or action of igniting: such as the starting of a fireINFLAME: to set on fire: to kindle; to burst into flameLIGHT: to take fire; to set fire to; to ignite something; also, a flame for lighting something (such as a cigarette) (give me a light); also, a candleLIGHTED: to take fire; to set fire to; to ignite somethingLIGHTING: ignition: the act or action of igniting: such as the starting of a fire; to take fire; to set fire to; to ignite somethingLINK: a torch formerly used to light a person's way through the streetsLIVE: afire, glowing (live coals)MADE: to assemble and set alight the materials for (a fire)MAKE: to assemble and set alight the materials for (a fire)MAKING: to assemble and set alight the materials for (a fire)MATCH: a short slender piece of flammable material (such as wood) tipped with a combustible mixture that bursts into flame when slightly heated through friction (as by being scratched against a rough surface)PUNK: a preparation (as of a stick of coated wood) that burns slowly and is used to ignite fuses, especially of fireworksPYRO: Not in M-W; Collins has slang: a person with a compulsion to set destructive fires; pyromaniacTIME: timed to ignite or explode at a specific moment (a time charge)TONGUE: a tapering flame (tongues of fire)TORCH: a burning stick of resinous wood or twist of tow used to give light and usually carried in the hand: a flambeau; also, any of various portable devices for emitting an unusually hot flame [e.g., a blowtorch]; also, to set fire to with or as if with a torchTRAIN: a line of combustible material laid to lead fire to a charge (A train of powder)UNBURNT: or unburned, not burned, not consumed by fireUNLIT: not lighted: such as not kindled or ignited (an unlit fire, an unlit cigar)VENTILATE: to provide an opening in (a burning structure) to permit escape of smoke and heatWICK: a bundle of fibers or a loosely twisted, braided, or woven cord, tape, or tube usually of soft spun cotton threads that by capillarity draws up to be burned a steady supply of the oil in lamps or the melted tallow or wax in candles
Fuels other than wood
BURN: to use (something) as fuel (this furnace burns gas)BURNING: to use (something) as fuel (this furnace burns gas)BURNT: to use (something) as fuel (this furnace burns gas)COAL: charcoal, or a black or brownish-black solid combustible substance … widely used as a natural fuelCOKE: the residue of coal left after destructive distillation and used as fuelCOKED*: converted to coke (from coal dust)DUFF: fine coal; slack, that is, the finest screenings of coal produced at a mine unusable as fuel unless cleanedETHANE: a colorless odorless gaseous alkane C2H6 found in natural gas and used as a fuelETHANOL: a colorless volatile flammable liquid C2H5OH that is the intoxicating agent in liquors and is also used as a solvent and in fuelFRACK: the injection of fluid into shale beds at high pressure in order to free up petroleum resources (such as oil or natural gas). Short for (hydraulic) fracturingFUEL: a material used to produce heat or power by burning; also, to provide with fuelFUELED: to provide with fuelFUELING: to provide with fuelLEAN: low in combustible component —used especially of fuel mixturesLEANLY: low in combustible component —used especially of fuel mixturesMETHANE: a colorless odorless flammable gaseous hydrocarbon CH4 that is a product of biological decomposition of organic matter and of the carbonization of coal, is used as a fuel and as a starting material in chemical synthesis, and is the simplest of the alkanesOILED: to take on fuel oilOILING: to take on fuel oilOILY: of, relating to, or consisting of oilPEAT: a dark brown fibrous material that is formed primarily by the partial decomposition of organic matter and especially plants (such as sphagnum moss) in wet, oxygen-deficient areas (such as bogs or swamps) and that is harvested especially for use as a fuel for heating or cooking or as a soil amendment; also, peat moss: sphagnum moss that has become compacted with other plant debris to form peat; also, dried and processed peat used especially as a soil amendmentRANK: any of a series of classes of coal based on increasing alteration of the parent vegetable matter, increasing carbon content, and increasing fuel valueRICH: high in the combustible component (a rich fuel mixture)WOOD: wood suitable or prepared for some use (such as burning or building)
Heat
ABOIL: being at the boiling point: boilingBAKE: to be or become extremely hot (sidewalks baking in the sun)BAKED: to be or become extremely hot (sidewalks baking in the sun)BAKING: to be or become extremely hot (sidewalks baking in the sun)BLAZING: (adj.) of outstanding power, speed, heat, or intensity (blazing eyes, a blazing fastball)BOIL: to come to the boiling pointBOILED: to come to the boiling pointBOILING: to come to the boiling pointBROIL: to be subjected to great or oppressive heatBURN: to be hot (the burning sand)BURNING: to be hot (the burning sand)BURNT: to be hot (the burning sand)CALORIC: (adj.) of or relating to heat; also, (noun) a supposed form of matter formerly held responsible for the phenomena of heat and combustionCALORIFIC: calorific; of or relating to heat productionCOOK: to experience heat (We’re cooking here in the sun.) [not culinary]COOKED: to experience heat (We’re cooking here in the sun.) [not culinary]COOKING: to experience heat (We’re cooking here in the sun.) [not culinary]EMIT: to throw or give off or out (emit light/heat)EMITTED: to throw or give off or out (emit light/heat)EMITTING: to throw or give off or out (emit light/heat)GLOW: to experience a sensation of or as if of heatGLOWING: to experience a sensation of or as if of heatHEAT: physics: added energy that causes substances to rise in temperature, fuse, evaporate, expand, or undergo any of various other related changes, that flows to a body by contact with or radiation from bodies at higher temperatures, and that can be produced in a body (as by compression); also, the energy associated with the random motions of the molecules, atoms, or smaller structural units of which matter is composed; a condition of being hot: warmth (snow melting in the heat of the sun); a marked or notable degree of hotness (The heat was intense.); a hot place or situation (come in and get out of the heat); a period of heat (an unbroken heat); a single complete operation of making something warm or hot; also: the quantity of material so heated; appearance, condition, or color of something as indicating its temperature (when the rod is at the proper welding heat); to become warm or hot (water heating in a kettle); to make warm or hot (heat the oven to 350 degrees); to start to spoil from heatHEATABLE: able to be heatedHEATED: a condition of being hot: warmth (snow melting in the heat of the sun); a marked or notable degree of hotness (The heat was intense.); a hot place or situation (come in and get out of the heat); a period of heat (an unbroken heat); a single complete operation of making something warm or hot; also: the quantity of material so heated; appearance, condition, or color of something as indicating its temperature (when the rod is at the proper welding heat); to become warm or hot (water heating in a kettle); to make warm or hot (heat the oven to 350 degrees); to start to spoil from heatMELTY: hot, having a relatively high temperaturePARCH: to shrivel with heatRADIANT: emitting or relating to radiant heatTEMP: short for temperature: degree of hotness or coldness measured on a definite scaleTEPID: moderately warm: lukewarm (a tepid bath)THAW: to become free of the effect (such as stiffness, numbness, or hardness) of cold as a result of exposure to warmthTHAWED: to become free of the effect (such as stiffness, numbness, or hardness) of cold as a result of exposure to warmthTORRID: parched with heat especially of the sun: hot (torrid sands); giving off intense heat: scorchingTORRIDITY: torridness, the quality or state of being torrid: parched with heat especially of the sun: hot (torrid sands); giving off intense heat: scorchingWARM: having or giving out heat to a moderate or adequate degree; serving to maintain or preserve heat especially to a satisfactory degree; also, to make warm; to become warmWARMING: having or giving out heat to a moderate or adequate degree; serving to maintain or preserve heat especially to a satisfactory degree; also, to make warm; to become warmWHITE: heated to the point of whiteness (molten white metal)
Heating and Heating Equipment
CHIMNEY: a vertical structure incorporated into a building and enclosing a flue or flues that carry off smoke, especially: the part of such a structure extending above a roof; a smokestackCLIMATE: the prevailing set of conditions (as of temperature and humidity) indoorsDRAFT: a device for regulating the flow of air (as in a fireplace) (open the draft)FLUE: a channel in a chimney for conveying flame and smoke to the outer air, or a pipe for conveying flame and hot gases around or through water in a steam boilerFUNNEL: a stack or flue for the escape of smoke or for ventilation (as on a ship)HEAT: chiefly US: a system that is used to provide warmth to a room or building (turn on the heat)PILOT: a pilot light, a small permanent flame used to ignite gas at a burnerPOTBELLY: a potbellied stove, a stove with a rounded or bulging body; called also potbelly stoveRADIANT: emitting or relating to radiant heat; also, the part of a gas or electric heater that becomes incandescentTHIMBLE: a lining (as of metal) for an opening (as in a roof or wall) through which a stovepipe or chimney passesUNHEATED: not heated (a small unheated shed, unheated leftovers)VENT: an opening for the escape of a gas or liquid or for the relief of pressure; also, to provide with a vent; to serve as a vent for (chimneys vent smoke)VENTED: an opening for the escape of a gas or liquid or for the relief of pressure; also, to provide with a vent; to serve as a vent for (chimneys vent smoke)
Illumination and Lighting Equipment
BULB: a glass envelope enclosing the light source of an electric lamp or such an envelope together with the light source it enclosesCANDELA: the base unit of luminous intensity in the International System of UnitsCANDLE: a candela, the base unit of luminous intensity in the International System of UnitsCANDLE: a usually molded or dipped mass of wax or tallow containing a wick that may be burned (as to give light, heat, or scent or for celebration or votive purposes); also, something resembling a candle in shape or use (a sulfur candle for fumigating)CHIMNEY: a tube usually of glass placed around a flame (as of a lamp)FLOOD: a floodlight, an artificial illumination in a broad beam; also, a source of such illumination; also, a lighting unit for projecting a broad beam of lightfloodlight; also, to illuminate by means of one or more floodlightsFLOODED: a floodlight, an artificial illumination in a broad beam; also, a source of such illumination; also, a lighting unit for projecting a broad beam of lightfloodlight; also, to illuminate by means of one or more floodlightsFLOODING: a floodlight, an artificial illumination in a broad beam; also, a source of such illumination; also, a lighting unit for projecting a broad beam of lightfloodlight; also, to illuminate by means of one or more floodlightsHEADLAMP: the beam of light cast by a headlightINCIDENCE: the angle of incidence: the angle that a line (such as a ray of light) falling on a surface or interface makes with the normal drawn at the point of incidence; also, the arrival of something (such as a projectile or a ray of light) at a surfaceLAMP: any of various devices for producing light or sometimes heat: such as a vessel with a wick for burning an inflammable liquid (such as oil) to produce light; or a glass bulb or tube that emits light produced by electricity (such as an incandescent light bulb or fluorescent lamp);LIGHT: an electric lightLIGHTBULB: more commonly “light bulb,” an electric lamp: such as one in which a filament gives off light when heated to incandescence by an electric current; also, one having a coating of fluorescent material on its inner surface that emits visible light: a fluorescent lamp, especially a compact fluorescent light; also, one using LEDs to generate lightLIMELIGHT: a stage lighting instrument producing illumination by means of an oxyhydrogen flame directed on a cylinder of lime and usually equipped with a lens to concentrate the light in a beam; also, the white light produced by such an instrumentLINK: a torch formerly used to light a person's way through the streetsLUMEN: a unit of luminous flux equal to the light emitted in a unit solid angle by a uniform point source of one candle intensityMANTLE: a lacy hood or sheath of some refractory material that gives light by incandescence when placed over a flameNAKED: not provided with a shade (a naked light bulb)NEON: a discharge lamp in which the gas contains a large proportion of neon; also, the illumination provided by such lampsNIGHTLIGHT: M-W has night-light, a light kept burning throughout the nightOPTICAL: using the properties of light to aid vision (an optical instrument); also, of, relating to, or utilizing light especially instead of other forms of energy(optical microscopy)UNLIT: not lighted: such as not illuminated with light (unlit roads, an unlit stairway)UPLIT: not in M-W; Collins has uplight, in British English, verb; -lights, -lighting, -lighted or -lit (transitive) to light in an upward directionWICK: a bundle of fibers or a loosely twisted, braided, or woven cord, tape, or tube usually of soft spun cotton threads that by capillarity draws up to be burned a steady supply of the oil in lamps or the melted tallow or wax in candles
Light
ABLAZE: radiant with light or emotionAGLEAM: gleaming especially with reflected lightALIGHT: lighted up (e.g., the sky was alight with stars)AURA: a luminous radiation: a nimbusBACKLIT: lit from behindBATHE: to suffuse with or as if with lightBATHING: to suffuse with or as if with lightBEAM: a ray or shaft of light; also, to emit in beams or as a beam (The sun beamed its light through the window.); to send out rays of light (Sunlight beamed through the window.)BEAMED: a ray or shaft of light; to emit in beams or as a beam (The sun beamed its light through the window.); to send out rays of light (Sunlight beamed through the window.)BEAMING: a ray or shaft of light; to emit in beams or as a beam (The sun beamed its light through the window.); to send out rays of light (Sunlight beamed through the window.)BLAZE: intense direct light often accompanied by heat (the blaze of TV lights); also, to burn brightly (the sun blazed overhead); also, (adj.) burning very brightly and intensely (a blazing fire)BLAZING: to burn brightly (the sun blazed overhead); also, (adj.) burning very brightly and intensely (a blazing fire)BLINK: to shine dimly or intermittently; to glimmer, sparkleBRILLIANT: very bright: glittering (a brilliant light)BURN: to give off light: to shine, glowBURNING: to give off light: to shine, glowBURNT: to give off light: to shine, glowCANDOR: literary: brightness, brillianceCHINK*: a narrow beam of light shining through a chinkDAWN: the first appearance of light in the morning followed by sunrise; to begin to grow light as the sun risesDAWNED: the first appearance of light in the morning followed by sunrise; to begin to grow light as the sun risesDAWNING: the first appearance of light in the morning followed by sunrise; to begin to grow light as the sun risesDAYLIT: illuminated by daylightDAYTIME: the time during which there is daylightDAZE: to dazzle with lightDAZED: to dazzle with lightDAZING: to dazzle with lightDAZZLE: to lose clear vision especially from looking at bright light; to shine brilliantly; to overpower with lightDAZZLED: to lose clear vision especially from looking at bright light; to shine brilliantly; to overpower with lightDAZZLING: to lose clear vision especially from looking at bright light; to shine brilliantly; to overpower with lightEMIT: to throw or give off or out (emit light/heat)EMITTED: to throw or give off or out (emit light/heat)EMITTING: to throw or give off or out (emit light/heat)ENHALO*: to surround with or as if with a haloFLAME: brilliance, brightness; also, to shine brightly: to glow (color flaming up in her cheeks)FLAT: of lighting conditions: lacking shadows or contoursGILT: superficial brillianceGLANCE: a quick intermittent flash or gleam; also, to flash or gleam with quick intermittent rays of lightGLANCED: to flash or gleam with quick intermittent rays of lightGLANCING: to flash or gleam with quick intermittent rays of lightGLARING: shining with or reflecting an uncomfortably bright lightGLARINGLY: shining with or reflecting an uncomfortably bright lightGLEAM: a transient appearance of subdued or partly obscured light; a small bright light; a glint; also, to shine with or as if with subdued steady light or moderate brightness; to cause to gleamGLEAMED: a transient appearance of subdued or partly obscured light; a small bright light; a glint; also, to shine with or as if with subdued steady light or moderate brightness; to cause to gleamGLEAMY: of a gleam or gleams: having a transient appearance of subdued or partly obscured light; a small bright light; a glintGLINT: to give off reflection in brilliant flashes; to gleam; to cause to glint; of rays of light: to be reflected at an angle from a surfaceGLINTING: to give off reflection in brilliant flashes; to gleam; to cause to glint; of rays of light: to be reflected at an angle from a surfaceGLORIFY: to light up brilliantlyGLORY: a ring or spot of light: such as an aureole, or a halo appearing around the shadow of an objectGLOW: light such as is emitted by a solid body heated to luminosity: incandescence; also, to shine with or as if with an intense heatGLOWING: light such as is emitted by a solid body heated to luminosity: incandescence; also, to shine with or as if with an intense heatHEIGHTEN: to make brighter or more intense: deepen; to become brighter or more intenseHEIGHTENING: to make brighter or more intense: deepen; to become brighter or more intenseHIGHLIGHT: a spot or area that is lighter than surrounding spots or areas; also, to throw a strong light on (The moon highlighted the tree tops.)HIGHLIGHTED: a spot or area that is lighter than surrounding spots or areas; also, to throw a strong light on (The moon highlighted the tree tops.)HIGHLIGHTING: a spot or area that is lighter than surrounding spots or areas; also, to throw a strong light on (The moon highlighted the tree tops.)IGNITE: to render luminous by heatIGNITING: to render luminous by heatIGNITION: to render luminous by heatLIGHT: to become light: to brighten; to illuminate (light up the room); also, having light: bright; a source of lightLIGHTED: to become light: to brighten; to illuminate (light up the room); also, having light: bright; a source of lightLIGHTEN: to make light or clear: to illuminate; to grow lighter: to brightenLIGHTENING: to make light or clear: to illuminate; to grow lighter: to brightenLIGHTING: to become light: to brighten; to illuminate (light up the room); also, having light: bright; a source of lightLIMPID: marked by transparency, having the property of transmitting light without appreciable scattering so that bodies lying beyond are seen clearly: pellucid (limpid streams)LIQUID: shining and clear (large liquid eyes)LIQUIDLY: shining and clear (large liquid eyes)LUCENT: glowing with light: luminous; marked by clarity or translucence: clearLUCID: suffused with light: luminous; translucentLUCIDLY: suffused with light: luminous; translucentMOON: moonlight (keep out of the moon or it may turn your head)MOONBEAM: a ray of light from the moonMOONLIT: lighted by the moonMOONY: moonlitPOOL: a pool of lightRADIANT: radiating rays or reflecting beams of light; vividly bright and shining: glowingRAYING: to shine in or as if in raysTHIN: lacking in intensity or brilliance (thin light); also, to become thin or thinnerTHINLY: in a thin manner: lacking in intensity or brilliance (thin light); also, to become thin or thinnerTHINNING: lacking in intensity or brilliance (thin light); also, to become thin or thinnerTHROUGH: used as a function word to indicate the transmission of light or vision by some opening or medium (looking through binoculars)THROW: the distance that light rays may be projected; also, to shed, to give off or out (to throw some light on the matter); to send forth: to project (the setting sun threw long shadows)THROWN: the distance that light rays may be projected; also, to shed, to give off or out (to throw some light on the matter); to send forth: to project (the setting sun threw long shadows)TWILIGHT: the light from the sky between full night and sunrise or between sunset and full night produced by diffusion of sunlight through the atmosphere and its dust; especially: such light immediately following sunset; also, a time of twilightTWILIT: lighted by or as if by twilight; from twilight + litTWINKLE: an intermittent radiance: a flicker, sparkle; also, to shine with a flickering or sparkling light: to scintillate (stars twinkling); to cause to shine with fluctuating lightTWINKLY: twinkling, beaming, smilingUNDIMMED: not made dim or dimmer: not dimmedUPLIT: not in M-W; Collins has uplight, in British English, verb; -lights, -lighting, -lighted or -lit (transitive) to light in an upward directionWINK: to gleam or flash intermittently: to twinkle (… her glasses winking in the sunlight. —Harper Lee)WINKING: to gleam or flash intermittently: to twinkle (… her glasses winking in the sunlight. —Harper Lee)WINKLE: to twinkle: to shine with a flickering or sparkling light: to scintillate (stars twinkling); to cause to shine with fluctuating light
Optics and Optical Equipment
BIAXIAL: having or relating to two axes or optic axesBIAXIALLY*: having or relating to two axes or optic axesDIFFRACT: to cause diffraction, a modification which light undergoes especially in passing by the edges of opaque bodies or through narrow openings and in which the rays appear to be deflectedEYECUP: a usually rubber cup at the eyepiece of an optical instrument (such as binoculars) for keeping out extraneous lightEYEPIECE: the lens or combination of lenses at the eye end of an optical instrumentFIELD: the area visible through the lens of an optical instrumentFOCAL: of, relating to, being, or having a focusFOCI: of, relating to, being, or having a focusINACTIVE: optically neutral in polarized lightLOUPE: a small magnifier used especially by jewelers and watchmakersMIRROR: a polished or smooth surface (as of glass) that forms images by reflection; also, to reflect in or as if in a mirrorMIRRORING: to reflect in or as if in a mirrorOCULAR: an eyepiece, the lens or combination of lenses at the eye end of an optical instrumentOPTIC: an optical instrument; also, any of the elements (such as lenses, mirrors, or light guides) of an optical instrument or system —usually used in plural; also, plural in form but usually singular in construction: a science that deals with the genesis and propagation of light, the changes that it undergoes and produces, and other phenomena closely associated with itOPTICAL: of or relating to the science of optics; also, of, relating to, or being objects that emit light in the visible range of frequencies (an optical galaxy); also, visible (an optical wavelength); also, using the properties of light to aid vision (an optical instrument); also, of, relating to, or utilizing light especially instead of other forms of energy (optical microscopy)PHOTIC: of, relating to, or involving light especially in relation to organisms; penetrated by light especially of the sun (the photic zone of the ocean)PHOTON: (dated) a troland, a unit of intensity of light at the retina equal to the illumination received per square millimeter of a pupillary area from a surface having a brightness of one candle per square meterPHOTOPIC: relating to or being vision in bright light with light-adapted eyes that is mediated by the cones of the retinaTAIN*: Not in M-W. Collins has a thin tin plate; or tin foil for the backs of mirrorsTEMPLE: one of the side supports of a pair of glasses jointed to the bows and passing on each side of the headTHROUGH: used as a function word to indicate the transmission of light or vision by some opening or medium (looking through binoculars)ZOOM: to focus a camera or microscope on an object using a zoom lens so that the object's apparent distance from the observer changes —often used with in or out; also, an image created by zooming; also, a means of producing an enlarged image (as in a camera), specifically: a zoom lensZOOMED: to focus a camera or microscope on an object using a zoom lens so that the object's apparent distance from the observer changes —often used with in or out; also, an image created by zooming; also, a means of producing an enlarged image (as in a camera), specifically: a zoom lens
Silence and Quiet
DAMP: to check the vibration or oscillation of (something, such as a string or a voltage); also, to dampen, to diminish progressively in vibration or oscillationDAMPED: to check the vibration or oscillation of (something, such as a string or a voltage); also, to dampen, to diminish progressively in vibration or oscillationDEAD: the time of greatest quiet (the dead of night)DEADEN: to make (something, such as a wall) impervious to soundDEADENED: to make (something, such as a wall) impervious to soundDEADENING: to make (something, such as a wall) impervious to soundDEAFEN: to make permanently or temporarily deaf (was deafened by the explosion)DEAFENED: to make permanently or temporarily deaf (was deafened by the explosion)DEAFENING: to make permanently or temporarily deaf (was deafened by the explosion); also, something that deafens; also, very loud: earsplittingDUMB: to make silent: to deadenDUMBED: to make silent: to deadenFADE: to change gradually in loudness, strength, or visibilityFADED: to change gradually in loudness, strength, or visibilityFADING: to change gradually in loudness, strength, or visibilityFALL: to drop in pitch or volume (their voices fell to a whisper)FALLEN: to drop in pitch or volume (their voices fell to a whisper)FALLING: to drop in pitch or volume (their voices fell to a whisper)FALLS: to drop in pitch or volume (their voices fell to a whisper)FELL: to drop in pitch or volume (their voices fell to a whisper)MUTE: to muffle, reduce, or eliminate the sound ofMUTED: to muffle, reduce, or eliminate the sound ofMUTING: to muffle, reduce, or eliminate the sound ofPADDED: to mute, to mufflePADDING: to mute, to muffleQUIET: making or involving no noise or very little noise; also, to become quiet —usually used with downQUIETEN*: M-W: chiefly British: to quietQUIETING: making or involving no noise or very little noise; also, to become quiet —usually used with down
Sounds and Noises not hearing, not recordings
AMPLIFY: to make louderAUDIBLY: heard or capable of being heardBANG: a sudden loud noise; also, to strike with a sharp noise or thump; to produce a sharp often metallic explosive or percussive noise or series of such noises
BANGED: a sudden loud noise; also, to strike with a sharp noise or thump; to produce a sharp often metallic explosive or percussive noise or series of such noisesBANGING: a sudden loud noise; also, to strike with a sharp noise or thump; to produce a sharp often metallic explosive or percussive noise or series of such noisesBEEP: a short usually high-pitched sound (as from a horn or an electronic device) that serves as a signal or warningBEEPING: to sound a horn; to make a beepBLAM: a sudden loud noise: usually used as an interjectionBLARING: to sound loud and strident (radios blaring); to sound or utter raucously (sat blaring the car horn)BLAT: to make a raucous noise; also, the sound made by blattingBLEEP: a short high-pitched sound (as from electronic equipment)BLIP: a short crisp soundBOING: a reverberating metallic sound made by or as if by a springBONG: the deep resonant sound especially of a bellBOOM: to make a deep hollow soundBOOMED: to make a deep hollow soundBOOMING: to make a deep hollow soundBOOMY: to make a deep hollow soundBOOP: It’s not in M-W (unabridged), but NOAD includes it as follows: Informal North American English verb (of an electronic device): [to] emit a short low-pitched noise; also noun: A short low-pitched noise emitted by an electronic deviceBOWWOW: a noisy clamorBRAWL: to make a loud confused noise; also, a loud tumultuous noiseBUBBLE: a sound of or like that of bubbling or gurgling liquid (e.g., bubbles of laughter)BUMBLE: to buzz; to drone, rumbleBUMBLED: to buzz; to drone, rumbleCACOPHONY: harsh or jarring sound: dissonance CARRY: to reach or penetrate to a distance (sound carries over the water)CARRYING: to reach or penetrate to a distance (sound carries over the water)CHUG: a dull explosive sound made by or as if by a laboring engineCHUGGING: a dull explosive sound made by or as if by a laboring engineCLAMOR: noisy shouting (a clamor of children at play); a loud continuous noise (the clamor of the waterfall); also, to make a din, a loud continued noise (the children clamored)CLANG: a loud ringing metallic sound (the clang of a fire alarm); also, to make a loud metallic ringing sound (anvils clanged); to cause to clang (clang a bell)CLANGED: a loud ringing metallic sound (the clang of a fire alarm); also, to make a loud metallic ringing sound (anvils clanged); to cause to clang (clang a bell)CLANGING: a loud ringing metallic sound (the clang of a fire alarm); also, to make a loud metallic ringing sound (anvils clanged); to cause to clang (clang a bell)CLANK: a sharp brief metallic ringing sound; also, to make a clank or series of clanks; to go with or as if with a clank (carts clanking through the streets; to cause to clankCLANKING: a sharp brief metallic ringing sound; also, to make a clank or series of clanks; to go with or as if with a clank (carts clanking through the streets; to cause to clankCLAP: to strike (two things, such as two flat, hard surfaces) together so as to produce a sharp percussive noise; to produce a percussive sound especially: to slam; also, a device that makes a clapping noiseCLICK: a slight sharp noise; also, to strike, move, or produce with a click (clicked his heels together); to make a clickCLICKED: a slight sharp noise; also, to strike, move, or produce with a click (clicked his heels together); to make a clickCLICKING: a slight sharp noise; also, to strike, move, or produce with a click (clicked his heels together); to make a clickCLINK: a clinking sound; also, to give out a slight sharp short metallic sound; to cause to clinkCLINKING: a clinking sound; also, to give out a slight sharp short metallic sound; to cause to clinkCLONK: to make a dull hollow thumping sound; to cause to clonkCLOP: a sound made by or as if by a hoof or wooden shoe against the pavement; also, to make such a soundCLOPPED: a sound made by or as if by a hoof or wooden shoe against the pavement; also, to make such a soundCLUNK: a blow or the sound of a blow: a thump; to make a clunk; to hit something with a clunk; to strike or hit with a clunkCLUNKED: a blow or the sound of a blow: a thump; to make a clunk; to hit something with a clunk; to strike or hit with a clunkCOUGH: to make a noise like that of coughing (The engine coughed and sputtered and then stopped.)COUGHING: to make a noise like that of coughing (The engine coughed and sputtered and then stopped.)CRACK: to make a very sharp explosive sound; also, a sudden sharp noise (the crack of rifle fire); to cause to make a sharp noise (cracks his knuckles); also, a loud roll or peal (a crack of thunder); also, to strike with a sharp noise: to rapCRUNCH: a sound made by crunching (the crunch of leaves underfoot); the quality of being crunchy: the tendency to make a crunching sound when chewed or pressed (the celery adds crunch)CRUNCHY: making a crunching sound when chewed or pressedDARK: possessing depth and richness (a dark voice)DARKLY: possessing depth and richness (a dark voice)DING: a sharp ringing sound; also, to make a ringing sound: to clangDINGED: a sharp ringing sound; also, to make a ringing sound: to clangDINGING: a sharp ringing sound; also, to make a ringing sound: to clangDRILL: a drilling soundDRONING: to make a sustained deep murmuring, humming, or buzzing soundDROWN: to cause (a sound) not to be heard by making a loud noise —usually used with out (turned up the radio to drown out the noise)
DROWNING: to cause (a sound) not to be heard by making a loud noise —usually used with out (turned up the radio to drown out the noise)DULL: not resonant or ringing (a dull thud)DULLY: not resonant or ringing (a dull thud)ECHO: the repetition of a sound caused by reflection of sound waves; the sound due to such reflection; also, to send back (a sound) by the reflection of sound waves; also, to resound with echoes; to produce an echoECHOED: the repetition of a sound caused by reflection of sound waves; the sound due to such reflection; also, to send back (a sound) by the reflection of sound waves; also, to resound with echoes; to produce an echoECHOIC: of or relating to an echo; also, formed in imitation of some natural sound: onomatopoeicECHOING: the repetition of a sound caused by reflection of sound waves; the sound due to such reflection; also, to send back (a sound) by the reflection of sound waves; also, to resound with echoes; to produce an echoEDGE: a noticeably harsh or sharp quality (her voice had an edge to it; the harsh bell had an edge to it)FADE: to change gradually in loudness, strength, or visibilityFADED: to change gradually in loudness, strength, or visibilityFADING: to change gradually in loudness, strength, or visibilityFLIPFLOP: M-W hyphenates flip-flop: the sound or motion of something flapping looselyFOOTFALL: the sound of a footstepFROUFROU: rustling [sound] especially of a woman's skirtsFULL: having volume or depth of sound (full tones)GOING: present participle of to go, to make (a characteristic sound) (The gun went bang.) (the cow goes “moo”)GOLDEN: mellow, resonant (a smooth golden tenor)GONE: past participle of to go, to make (a characteristic sound) (The gun went bang.) (the cow goes “moo”)GONG: a saucer-shaped bell (as in a fire alarm) that is struck by a mechanical hammerGONGED: sounded a gong, a saucer-shaped bell (as in a fire alarm) that is struck by a mechanical hammerGONGING: sounding a gong, a saucer-shaped bell (as in a fire alarm) that is struck by a mechanical hammer
GRIT: to give forth a grating sound (dry snow gritting beneath our feet)GROAN: to make a harsh sound (as of creaking) under sudden or prolonged strainGROANING: to make a harsh sound (as of creaking) under sudden or prolonged strainGURGLING: to make a sound like that of a gurgling liquidHOLLOW: reverberating like a sound made in or by beating on a large empty enclosure: muffled (a hollow sound)HONK: to make a sound like the characteristic cry of a gooseHONKING: to make a sound like the characteristic cry of a gooseHUBBUB: noise, uproar, confusion, turmoilIMITATIVE: reproducing or representing a natural sound: onomatopoeicJINGLING: a light clinking or tinkling sound; also, something that jingles; also, to make a light clinking or tinkling sound, or to cause to jingleJINGLY: a light clinking or tinkling sound; also, something that jingles; also, to make a light clinking or tinkling sound, or to cause to jingleKABOOM: the sound of an explosion or crash (heard a loud kaboom) —often used interjectionally (…the minute you build an emergency fund—kaboom! Along comes an "emergency.")KNELL: a stroke or sound of a bell especially when rung slowly (as for a death, funeral, or disaster); also, to ring especially for a death, funeral, or disaster: to toll; also, to summon or announce by or as if by a knell, or to sound in an ominous manner or with an ominous effectKNELLED: a stroke or sound of a bell especially when rung slowly (as for a death, funeral, or disaster); also, to ring especially for a death, funeral, or disaster: to toll; also, to summon or announce by or as if by a knell, or to sound in an ominous manner or with an ominous effectKNOCK: a pounding noise, or to make a pounding noiseKNOCKED: a pounding noise, or to make a pounding noiseKNOCKING: a pounding noise, or to make a pounding noiseLAPPED: to make a gentle, intermittent splashing sound (water lapping)LAPPING: to make a gentle, intermittent splashing sound (water lapping)LOUD: marked by intensity or volume of sound; producing a loud sound; clamorous, noisyLOUDEN: to become loud; to make loudLOUDENED: to become loud; to make loudLOUDLY: marked by intensity or volume of sound; producing a loud sound; clamorous, noisyLOWLY: not loudlyMETALLIC: having a harsh resonance: grating (a metallic voice)MURMUR: a low indistinct but often continuous sound (a murmur of voices, the murmur of waves along the shore)PANT: a throbbing or puffing sound; also, to move with or make a throbbing or puffing sound; to throb, to pulsatePANTING: a throbbing or puffing sound; also, to move with or make a throbbing or puffing sound; to throb, to pulsatePEAL: a loud sound or succession of sounds (peals of laughter, peals of thunder); also, to give out peals, to utter or give forth loudlyPEALED: a loud sound or succession of sounds (peals of laughter, peals of thunder); also, to give out peals, to utter or give forth loudlyPEEP: a feeble shrill sound: a cheep; also, to utter a feeble shrill sound as of a bird newly hatched: to cheepPEEPED: a feeble shrill sound: a cheep; also, to utter a feeble shrill sound as of a bird newly hatched: to cheepPEEPING: a feeble shrill sound: a cheep; also, to utter a feeble shrill sound as of a bird newly hatched: to cheepPHONIC: of, relating to, or producing sound: acousticPING: a sharp sound like that of a striking bullet; also, to make a ping; to ricochet with a ping; to cause to pingPINGED: a sharp sound like that of a striking bullet; also, to make a ping; to ricochet with a ping; to cause to pingPINGING: a sharp sound like that of a striking bullet; also, to make a ping; to ricochet with a ping; to cause to pingPIPE: syn. for piping: a sound, note, or call like that of a pipe, or the music of a pipe; also, to emit a shrill soundPIPED: syn. for piping: a sound, note, or call like that of a pipe, or the music of a pipe; also, to emit a shrill soundPIPING: syn. for piping: a sound, note, or call like that of a pipe, or the music of a pipe; also, to emit a shrill soundPITAPAT: Collins has pitapat; M-W hyphenates pit-a-pat, defined as pitter-patter, a rapid succession of light sounds or beats: patterPITCH: the property of a sound and especially a musical tone that is determined by the frequency of the waves producing it: the highness or lowness of soundPITCHY: of a sound: unpleasantly high or piercing: shrillPLANGENT: having a loud reverberating sound (a plangent roar); also, having an expressive and especially plaintive quality (the plangent sound of the oboe)PLINK: a tinkling metallic sound; also, to make a tinkling sound, to cause to make a tinkling soundPLINKING: a tinkling metallic sound; also, to make a tinkling sound, to cause to make a tinkling soundPLOP: to fall, drop, or move suddenly with a sound like that of something dropping into waterPLUMP: the sound made by a plump: a sudden plunge, fall, or blowPONG: a hollow ringing sound; also, to make a hollow ringing soundPOPPED: to make or burst with a sharp sound (a balloon popped)POPPING: to make or burst with a sharp sound (a balloon popped)POUND: an act or sound of pounding; also, to make a heavy repetitive soundPOUNDED: an act or sound of pounding; also, to make a heavy repetitive soundPUFF: a slight explosive sound accompanying a puff (heard the engine puffing); also, to make such a soundPUFFED: a slight explosive sound accompanying a puff (heard the engine puffing); also, to make such a soundPURL: a gentle murmur or movement (as of purling water); also, to make a soft murmuring sound like that of a purling streamPURR: a low vibratory murmur typical of an apparently contented or pleased cat; also, to make a purr or a sound like a purr (cars purring along the highway)PURRING: a low vibratory murmur typical of an apparently contented or pleased cat; also, to make a purr or a sound like a purr (cars purring along the highway)RANG: a clear resonant sound made by or resembling that made by vibrating metal; resonant tone: sonority; a loud sound continued, repeated, or reverberated; the act or an instance of ringing; to cause to sound especially by striking; to make (a sound) by or as if by ringing a bell; also, to sound resonantly or sonorously (the doorbell rang, cheers rang out); to be filled with a reverberating sound: to resound (the halls rang with laughter; to have the sensation of being filled with a humming sound (his ears were ringing after the concert); to summon especially by bell; to cause something to ring (as in giving a summons) (ring for service); to announce by or as if by ringing RAPPING: to make a short sharp soundRATATAT: M-W hyphenates rat-a-tat, a rapid succession of knocking, tapping, or cracking sounds; Collins and NOAD both hyphenate rat-a-tatRATTLY: likely to rattle: making a rattleRICH: full and mellow in tone and quality (a rich voice)RING: a clear resonant sound made by or resembling that made by vibrating metal; resonant tone: sonority; a loud sound continued, repeated, or reverberated; the act or an instance of ringing; to cause to sound especially by striking; to make (a sound) by or as if by ringing a bell; also, to sound resonantly or sonorously (the doorbell rang, cheers rang out); to be filled with a reverberating sound: to resound (the halls rang with laughter; to have the sensation of being filled with a humming sound (his ears were ringing after the concert); to summon especially by bell; to cause something to ring (as in giving a summons) (ring for service); to announce by or as if by ringing RINGING: clear and full in tone: resounding (a ringing baritone); also, [ring]: a clear resonant sound made by or resembling that made by vibrating metal; resonant tone: sonority; a loud sound continued, repeated, or reverberated; the act or an instance of ringing; to cause to sound especially by striking; to make (a sound) by or as if by ringing a bell; also, to sound resonantly or sonorously (the doorbell rang, cheers rang out); to be filled with a reverberating sound: to resound (the halls rang with laughter; to have the sensation of being filled with a humming sound (his ears were ringing after the concert); to summon especially by bell; to cause something to ring (as in giving a summons) (ring for service); to announce by or as if by ringing RIPPLY: a sound like that of rippling water (a ripple of laughter)ROAR: a loud continuous confused sound (the roar of the crowd); also, to make a long, loud sound (sirens roaring); to make or emit a loud confused sound (such as background reverberation or rumbling); also, to cause to roar (roaring their engines)ROARING: a loud continuous confused sound (the roar of the crowd); also, to make a long, loud sound (sirens roaring); to make or emit a loud confused sound (such as background reverberation or rumbling); also, to cause to roar (roaring their engines); also, making or characterized by a sound resembling a roar: loud (roaring applause)ROLL: a heavy reverberatory sound (the roll of cannon); also, to sound with a full reverberating tone (rolled out the words); to make a deep reverberating sound (the thunder rolls); to make a continuous beating sound upon: sound a roll upon (rolled their drums)ROTUND: marked by fullness of sound or cadence: orotund, sonorousROUND: a prolonged burst (as of applause)RUMOR: a soft low indistinct sound: a murmurRUNG: a clear resonant sound made by or resembling that made by vibrating metal; resonant tone: sonority; a loud sound continued, repeated, or reverberated; the act or an instance of ringing; to cause to sound especially by striking; to make (a sound) by or as if by ringing a bell; also, to sound resonantly or sonorously (the doorbell rang, cheers rang out); to be filled with a reverberating sound: to resound (the halls rang with laughter; to have the sensation of being filled with a humming sound (his ears were ringing after the concert); to summon especially by bell; to cause something to ring (as in giving a summons) (ring for service); to announce by or as if by ringing SOBS: a sound like that of a sob
SQUEAK: a sharp shrill cry or sound; also, to utter or make a short shrill cry or noiseSQUEAKS: a sharp shrill cry or sound; also, to utter or make a short shrill cry or noiseSQUEAKY: of the nature of, emitting, or tending to emit squeaksTANG: a clang, a ring[ing sound]; a sharp twanging soundTAPPED: to strike lightly especially with a slight sound; to strike a light audible blow: to rapTAPPING: to strike lightly especially with a slight sound; to strike a light audible blow: to rapTATTOO: a rapid rhythmic rapping; also, to beat or rap rhythmically on: to drum on; to give a series of rhythmic tapsTATTOOED: a rapid rhythmic rapping; also, to beat or rap rhythmically on: to drum on; to give a series of rhythmic tapsTATTOOING: a rapid rhythmic rapping; also, to beat or rap rhythmically on: to drum on; to give a series of rhythmic tapsTHIN: somewhat feeble, shrill, and lacking in resonance (a thin voice)THINLY: in a thin manner: somewhat feeble, shrill, and lacking in resonance (a thin voice)THROATY: heavy, thick, and deep as if from the throat (throaty notes of a horn)THUD: a dull sound: a thump; to move or strike so as to make a thudTHUDDED: a dull sound: a thump; to move or strike so as to make a thudTHUMP: a blow or knock with or as if with something blunt or heavy; also: the sound made by such a blow; to pound, knock, whip, or thrash; also, to inflict a thump or to make or move with a thumping soundTICK: a light rhythmic audible tap or beat; also: a series of such ticks; also, to make the sound of a tick or a series of ticksTICKING: a light rhythmic audible tap or beat; also: a series of such ticks; also, to make the sound of a tick or a series of ticksTICKTOCK: the ticking sound of a clockTINGING: ting, a high-pitched sound like that made by a light stroke on a crystal goblet; (v) [to make such a sound]TINGLING: to make or emit a tinkle or a sound suggestive of a tinkleTINKLE: a series of short high ringing or clinking sounds; also, to make or emit a tinkle or a sound suggestive of a tinkle; to sound or make known (the time) by a tinkle; to cause to make a tinkle; to produce by tinklingTINKLY: that tinkles: tinklingTINNY: thin in tone (a tinny voice)TOCK: M-W does not have this definition, from Collins: in British English: the sound made by a clock; also, to make the sound characteristic of a clock (There was silence in the kitchen except for the deep tock of the clock in the hall.)TOLL: the sound of a tolling bell; also, to sound with slow measured strokes (the bell tolls solemnly); to sound (a bell) by pulling the rope; to give signal or announcement of (the clock tolled each hour); to announce by tolling (church bells tolled the death of the bishop); to call to or from a place or occasion (bells tolled the congregation to church)TOLLED: the sound of a tolling bell; also, to sound with slow measured strokes (the bell tolls solemnly); to sound (a bell) by pulling the rope; to give signal or announcement of (the clock tolled each hour); to announce by tolling (church bells tolled the death of the bishop); to call to or from a place or occasion (bells tolled the congregation to church)TONAL: of or relating to tone, a sound of definite pitch and vibrationTONALLY: of or relating to tone, a sound of definite pitch and vibrationTONE: a sound of definite pitch and vibrationTOOT: a short blast (as on a horn); also: a sound resembling such a blast; also, to sound a short blast (the horn tooted: to sound a note or call suggesting the short blast of a wind instrument; to blow or sound an instrument (such as a horn) especially so as to produce short blasts; to cause to sound (toot a whistle)TOOTED: a short blast (as on a horn); also: a sound resembling such a blast; also, to sound a short blast (the horn tooted: to sound a note or call suggesting the short blast of a wind instrument; to blow or sound an instrument (such as a horn) especially so as to produce short blasts; to cause to sound (toot a whistle)TOOTING: a short blast (as on a horn); also: a sound resembling such a blast; also, to sound a short blast (the horn tooted: to sound a note or call suggesting the short blast of a wind instrument; to blow or sound an instrument (such as a horn) especially so as to produce short blasts; to cause to sound (toot a whistle)TOOTLE: to toot gently, repeatedly, or continuouslyTOOTLED: to toot gently, repeatedly, or continuouslyTRAMP: the succession of sounds made by the beating of feet on a surface (such as a road, pavement, or floor); also, to walk, tread, or step especially heavily; also, to tread on forcibly and repeatedlyTRILL: a sound resembling a musical trill: a warbleTRUMP: a trumpet; also, a sound of or as if of trumpeting (the trump of doom)TUBBY: sounding dull and without proper resonance or freedom of sound (a tubby violin)TUCK: a sound of or as if of a drumbeatTUMULT: hubbub, dinTWEET: a chirping note; also, to make a chirping soundTWEETED: a chirping note; also, to make a chirping soundULULANT*: (adj) having a howling sound: wailingUNMUTE: to allow (something previously muted) to produce sound again: to stop muting (something)UNMUTED: to allow (something previously muted) to produce sound again: to stop muting (something)UNTUNEFUL: not pleasing in sound: harshVEILED : characterized by a softening tonal distortionVIBRANT: sounding as a result of vibration: resonant (a vibrant voice)VROOM: to operate a motor vehicle at high speed or so as to create a great deal of engine noiseWAIL: a sound suggestive of wailing (the wail of an air-raid siren); also, to make a sound suggestive of a mournful cryWAILING: a sound suggestive of wailing (the wail of an air-raid siren); also, to make a sound suggestive of a mournful cryWENT: past tense of to go, to make (a characteristic sound) (The gun went bang.) (the cow goes “moo”)WHAM: the loud sound of a hard impact; also, to propel, strike, or beat so as to produce a loud impact; to hit or explode with a loud impactWHEEZE: to make a sound resembling that of wheezing (the bellows wheezed)WHEEZING: to make a sound resembling that of wheezing (the bellows wheezed)WHIFF: a slight puffing or whistling sound; also, to emit whiffs: to puff; to expel or puff out in a whiff: to exhaleWHINE: a sound resembling a whine, a prolonged high-pitched cry usually expressive of distress or pain (the whine of the chain saw); also, to make a sound similar to such a cry (The wind whined in the chimney.); to move or proceed with the sound of a whineWHINED: a sound resembling a whine, a prolonged high-pitched cry usually expressive of distress or pain (the whine of the chain saw); also, to make a sound similar to such a cry (The wind whined in the chimney.); to move or proceed with the sound of a whineWHINING: a sound resembling a whine, a prolonged high-pitched cry usually expressive of distress or pain (the whine of the chain saw); also, to make a sound similar to such a cry (The wind whined in the chimney.); to move or proceed with the sound of a whineWHININGLY: in a whining tone or manner (the boards creaked whiningly beneath their feet) (the child pleaded whiningly)WHINNY: a sound resembling a neighWHINY: characterized by whining: having a high-pitched, shrill or plaintive quality (a whiny mosquito)WHIR: or less commonly whirr, a continuous fluttering or vibratory sound made by something in rapid motion (the whir of machinery); also, to fly, revolve, or move rapidly with a whir (hummingbirds whirring past); to move or carry rapidly with a whirWHIRR: or more commonly whir, a continuous fluttering or vibratory sound made by something in rapid motion (the whir of machinery); also, to fly, revolve, or move rapidly with a whir (hummingbirds whirring past); to move or carry rapidly with a whirWHIZ: or whizz, a hissing, buzzing, or whirring sound; also, a movement or passage of something accompanied by a whizzing soundWHIZZ: or whiz, a hissing, buzzing, or whirring sound; also, a movement or passage of something accompanied by a whizzing soundWHIZZING: whiz or whizz, a hissing, buzzing, or whirring sound; also, a movement or passage of something accompanied by a whizzing soundWHOOP: to go or pass with a loud noiseWHOOPING: to go or pass with a loud noiseWIRY: of sound: produced by or suggestive of the vibration of wireZING: a shrill humming noise; also, to make or move with a humming soundZINGING: a shrill humming noise; also, to make or move with a humming soundZIPPED: to travel with a sharp hissing or humming soundZOOM: to move with a loud low hum or buzz; also, a zooming soundZOOMED: to move with a loud low hum or buzz; also, a zooming sound
Spelling Bee words related to
ENERGY, LIGHT, SOUND, HEAT
ABLAZEABOILAFLAMEAGLEAMALGID*ALIGHTAMPLIFYARCTICAUDIBLYAURABACKLITBACKLOGBAKEBAKEDBAKINGBANG
BANGEDBANGINGBANKBATHEBATHINGBEAMBEAMEDBEAMINGBEDIMBEDIMMEDBEEPBEEPINGBIAXIALBIAXIALLY*BILLETBLACKBLAMBLARINGBLATBLAZEBLAZINGBLEEPBLINDBLINDINGBLINKBLIPBOILBOILEDBOILINGBOINGBONGBOOMBOOMEDBOOMINGBOOMYBOOPBOWWOWBRAWLBRILLIANTBROILBUBBLEBULBBUMBLEBUMBLEDBURNBURNINGBURNTCACOPHONYCALORICCALORIFICCANDELACANDLECANDORCAPACITANCECAPACITORCAPACITYCARRYCARRYINGCATCHCELLCHARCHARGINGCHILLCHILLEDCHILLINGCHILLYCHIMNEYCHINK*CHUGCHUGGINGCLAMORCLANGCLANGEDCLANGINGCLANKCLANKINGCLAPCLICKCLICKEDCLICKINGCLIMATECLINKCLINKINGCLONKCLOPCLOPPEDCLUNKCLUNKEDCOALCOKECOKED*COLDCOLDLYCONDUCTCONDUCTEDCONDUCTIONCONVECTCONVECTIONCONVECTIVECOOKCOOKEDCOOKINGCOOLCOOLANTCOOLEDCOOLINGCOOLLYCORKBOARDCOUGHCOUGHINGCRACKCRUNCHCRUNCHYCRYONICDAMPDAMPEDDARKDARKLYDAWNDAWNEDDAWNINGDAYLITDAYTIMEDAZEDAZEDDAZINGDAZZLEDAZZLEDDAZZLINGDEADDEADENDEADENEDDEADENINGDEAFENDEAFENEDDEAFENINGDIFFRACTDIMMEDDIMMINGDINGDINGEDDINGINGDRAFTDRILLDRONINGDROWN
DROWNINGDUFFDULLDULLYDUMBDUMBEDECHOECHOEDECHOICECHOINGEDGEEMITEMITTEDEMITTINGENGINEENHALO*ETHANEETHANOLEYECUPEYEPIECEFADEFADEDFADINGFAINTFAINTLYFALLFALLENFALLINGFALLSFELLFIELDFLAMEFLATFLINTFLIPFLOPFLOODFLOODEDFLOODINGFLOWFLUEFOCALFOCIFOOTFALLFRACKFROUFROUFUELFUELEDFUELINGFULLFUMEDFUNNELGELIDGIGAWATTGILTGLACIALGLACIALLYGLANCEGLANCEDGLANCINGGLARINGGLARINGLYGLEAMGLEAMEDGLEAMYGLINTGLINTINGGLOOMGLOOMILYGLOOMINGGLOOMYGLORIFYGLORYGLOWGLOWINGGOINGGOLDENGONEGONGGONGEDGONGING
GRITGROANGROANINGGURGLINGHEADLAMPHEATHEATABLEHEATEDHEIGHTENHEIGHTENINGHIGHLIGHTHIGHLIGHTEDHIGHLIGHTINGHOLLOWHONKHONKINGHUBBUBHYDROICEDICILYIGNITEIGNITINGIGNITIONIMITATIVEINACTIVEINCIDENCEINFLAMEINPUT
JINGLINGJINGLYKABOOMKEELKEELEDKNELLKNELLEDKNOCKKNOCKEDKNOCKINGLAMPLAPPEDLAPPINGLEANLEANLYLIGHTLIGHTBULBLIGHTEDLIGHTENLIGHTENINGLIGHTINGLIMELIGHTLIMPIDLINKLIQUIDLIQUIDLYLIVELOADLOUDLOUDENLOUDENEDLOUDLYLOUPELOWLYLUCENTLUCIDLUCIDLYLUMENMACHINEMADEMAKEMAKINGMANTLEMATCHMELTYMETALLICMETHANEMIRRORMIRRORINGMOONMOONBEAMMOONLITMOONYMURMURMUTEMUTEDMUTINGNAKEDNEONNIGHTNIGHTLIGHTNIPPEDNIPPINGNIPPYNONCONDUCTORNUKEOCULAROILEDOILINGOILYOPTICOPTICALOUTPUTPADDEDPADDINGPALEPALEDPALINGPANTPANTINGPARCHPEALPEALEDPEATPEEPPEEPEDPEEPINGPHONICPHOTICPHOTOCELLPHOTONPHOTOPICPILEPILOTPINGPINGEDPINGINGPIPEPIPEDPIPINGPITAPATPITCHPITCHYPLANGENTPLANTPLATEPLINKPLINKINGPLOPPLUMPPONGPOOLPOPPEDPOPPINGPOTBELLYPOUNDPOUNDEDPUFFPUFFEDPUNKPURLPURRPURRINGPYROQUADQUANTAQUIETQUIETEN*QUIETINGRADIANTRADIATORRADIORANGRANKRAPPINGRATATATRATTLYRAYINGRICHRINGRINGINGRIPPLYROARROARINGROLLROTUNDROUNDRUMORRUNGSOBS
SQUEAKSQUEAKSSQUEAKYTAIN*TANGTAPPEDTAPPINGTATTOOTATTOOEDTATTOOINGTEMPTEMPLETEPIDTHAWTHAWEDTHIMBLETHINTHINLYTHINNINGTHROATYTHROUGHTHROWTHROWNTHUDTHUDDEDTHUMPTICKTICKINGTICKTOCKTIMETINGINGTINGLINGTINKLETINKLYTINNYTOCKTOLLTOLLEDTONALTONALLYTONETONGUETOOTTOOTEDTOOTINGTOOTLETOOTLEDTORCHTORRIDTORRIDITYTRAINTRAMPTRILLTRUMPTUBBYTUCKTUMULTTWEETTWEETEDTWILIGHTTWILITTWINKLETWINKLYULULANT*UMBRAUNBURNTUNDIMMEDUNHEATEDUNLITUNMUTEUNMUTEDUNTUNEFULUPLITVEILED VENTVENTEDVENTILATEVIBRANTVROOMWAILWAILINGWANEWANEDWANINGWARMWARMINGWATTWAVEWENTWHAMWHEEZEWHEEZINGWHIFFWHINEWHINEDWHININGWHININGLYWHINNYWHINYWHIRWHIRRWHITEWHIZWHIZZWHIZZINGWHOOPWHOOPINGWICKWINKWINKINGWINKLEWIRYWOODWORKWORKWRAITHZINGZINGINGZIPPEDZOOMZOOMED