LexiTopic: Time

If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to TIME in the Spelling Bee lexicon. The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to TIME
SUBJECT HEADINGS IN THIS LEXITOPIC: About Time general words about timeAfter, Late, LaterBefore, Early, Earlier Delay, Pausing, WaitingDuring, Duration, Passage of Time in generalFuture Geologic TimePast not historyPresentTimepieces and HorologyTimes and Time Periods day, night, seasons, etc.
NOTES ABOUT THE TAXONOMY FOR TIME SCOPE NOTE: This LexiTopic compiles and defines Bee words related to the phenomenon of time and its measurement, as well as how time is perceived and articulated by humans. Words related to events, dates, calendars, etc., are in EVENTS AND INCIDENTS. Words related to dawdling and wasting time are in MOTIONS: COMING AND GOING. Words related to the historical past are in HISTORY AND OLDEN TIMES.
Topical arrangement of Spelling Bee words related to TIME
About Time general words about time
ANYTIME: at any time whateverCIVIL: of time: based on the theoretical mean sun and legally recognized for use in ordinary affairs (the civil calendar)COLON: the sign: used between the parts of a numerical expression of timeDATE: to estimate or compute a date or chronology: to reckon chronologically (scientific dating techniques); also, to determine the period of time to which something belongs: to determine the date of (date an antique; dated the fossils to the Triassic period)DATED: to estimate or compute a date or chronology: to reckon chronologically (scientific dating techniques); also, to determine the period of time to which something belongs: to determine the date of (date an antique; dated the fossils to the Triassic period)DATING: to estimate or compute a date or chronology: to reckon chronologically (scientific dating techniques); also, to determine the period of time to which something belongs: to determine the date of (date an antique; dated the fossils to the Triassic period)EPOCH: an event or a time marked by an event that begins a new period or development; a memorable event or date; an extended period of time usually characterized by a distinctive development or by a memorable series of eventsINFINITE: extending indefinitely to infinity: endless; immeasurably or inconceivably great or extensive: inexhaustible; extending beyond, lying beyond, or being greater than any preassigned finite value however largeINFINITUDE: the quality or state of being infinite: infiniteness; something that is infinite especially in extentINFINITY: the quality of being infinite; unlimited extent of time, space, or quantity: boundlessnessINTO: used as a function word to indicate a period of time or an extent of space part of which is passed or occupied NEVER: not ever: at no time (I never met her)PAGE: a noteworthy event or periodTEMP: short for [Latin tempore] in the time ofTHEN: that time (since then); existing or acting at or belonging to the time mentioned (the then chairman); also, at that time TIME: a nonspatial continuum that is measured in terms of events which succeed one another from past through present to future; also, any of various systems (such as a sidereal or solar system) of reckoning timeTIMEZONE: M-W has time zone, a geographic region within which the same standard time is used; Collins has time zone; NOAD has no entry.TURN: the beginning of a new period of time: the time when one period changes to the next (the turn of the century, the turn of the year)TWEEN: between: in the time, space, or interval that separates; in intermediate relation toUNTIL: conjunction: up to the time that: up to such time as (play continued until it got dark, ran until she was breathless)UNTO: used as a function word in many different expressions concerning timeWHEN: at what time; at or during which time; and then; just at the moment that; at any or every time that (when he listens to music, he falls asleep); the time or occasion at or in which; what or which time; the time in which something is done or comes about
After, Late, Later
BELATE*: archaic: to retard or make lateFINALLY: after a prolonged time: at the end of period of time (It finally dawned on me)HIGH: verging on lateness —usually used in the phrase high time (It's high time he won an award.)LATE: coming or remaining after the due, usual, or proper time (a late spring, was late for class); of, relating to, or imposed because of tardiness (had to pay a late fee); after the usual or proper time (got to work late); at or to an advanced point of time; of or relating to an advanced stage in point of time or development: occurring near the end of a period of time or series (the late Middle Ages); far advanced toward the close of the day or night (late hours)LATEN: to grow late, to cause to grow lateLONG: at a point of time far before or after a specified moment or event (was excited long before the big day); after or beyond a specified or implied time (didn't stay longer than midnight)MORROW: the time immediately after a specified event OVER: till a later time (such as the next day): overnight (stay over, sleep over)TARDY: delayed beyond the expected or proper time: late (a tardy arrival); also, an instance of being tardy (as to a class)TARRY: to delay or be tardy in acting or doingTARRYING: to delay or be tardy in acting or doing
Before, Early, Earlier
ADVANCE: to bring forward in time, especially: to make earlierADVANCED: to bring forward in time, especially: to make earlierANTEDATE: to date as of a time prior to that of execution; to assign to a date prior to that of actual occurrence; a date assigned to an event or document earlier than the actual date of the event or documentANTEDATED: to date as of a time prior to that of execution; to assign to a date prior to that of actual occurrenceCOUNTDOWN: an audible backward counting in fixed units (such as seconds) from an arbitrary starting number to mark the time remaining before an event; also: preparations carried on during such a countINTRO: introductionLATE: made, appearing, or happening just previous to the present time especially as the most recent of a succession (our late quarrel)LONG: at a point of time far before or after a specified moment or event (was excited long before the big day); after or beyond a specified or implied time (didn't stay longer than midnight); extending far into the future (the thoughts of youth are long, long thoughts —H. W. Longfellow)MATUTINAL: of, relating to, or occurring in the morning: earlyMEANTIME: the time before something happens or before a specified period endsPOINT: a time interval immediately before something indicated: verge (at the point of death)PRIOR: earlier in time or orderTILL: or 'til or less commonly til: until, used as a function word to indicate continuance (as of an action or condition) to a specified time; also, beforeUNTIL: before, at an earlier time (not available until tomorrow, we don't open until ten)
Delay, Pausing, Waiting
ABIDE: to bear patiently; to waitABIDED: to bear patiently; to waitABIDING: to bear patiently; to waitADJOURN: to suspend indefinitely or until a later stated timeAWAIT: to wait forBALKY: refusing or likely to refuse to proceedBELATEDLY: delayed beyond the usual time; existing or appearing past the normal or proper timeBIDE: to wait for —used chiefly in the phrase bide one's time; to wait awhile: to tarry; to continue in a state or conditionBIDED: to wait for —used chiefly in the phrase bide one's time; to wait awhile: to tarry; to continue in a state or conditionBIDING: to wait for —used chiefly in the phrase bide one's time; to wait awhile: to tarry; to continue in a state or conditionBODE: past tense of bide, to stay, to waitCHECK: a sudden pause or break in a progression (the invaders coming in without a check); also, to halt through caution, uncertainty, or fear: to stop (The train checked with a jolt)CRANING: to hesitateDELAY: to stop, detain, or hinder for a time; to cause delay; the state of being delayed; to cause to be slower or to occur more slowly than normal; to move or act slowly DELAYABLE: not in M-W; Collins has “in British English” able to be delayedDELAYED: to stop, detain, or hinder for a time; to cause delay; the state of being delayed; to cause to be slower or to occur more slowly than normal; to move or act slowly DWELL: to remain for a time (dwell in the hallway)DWELLED: to remain for a time (dwell in the hallway)DWELLING: to remain for a time (dwell in the hallway)DWELT: to remain for a time (dwell in the hallway)MORATORIA: plural of moratorium, a waiting period set by an authorityQUEUE: a waiting line especially of persons or vehicles; also, to line up or wait in a queue —often used with upQUEUED: a waiting line especially of persons or vehicles; also, to line up or wait in a queue —often used with upQUEUEING: or queuing, a waiting line especially of persons or vehicles; also, to line up or wait in a queue —often used with upQUEUING: or queueing, a waiting line especially of persons or vehicles; also, to line up or wait in a queue —often used with upTARRY: to delay or be tardy in acting or doing; to linger in expectation: to wait; a stay, a sojourn; also, to abide or stay in or at a placeTARRYING: to delay or be tardy in acting or doing; to linger in expectation: to wait; a stay, a sojourn; also, to abide or stay in or at a placeVIGIL: an event or a period of time when a person or group stays in a place and quietly waits, prays, etc., especially at night (a candlelight vigil, kept vigil at her bedside)WAIT: a state or attitude of watchfulness and expectancy (in wait for the next event); an act or period of waiting (a long wait in line); to look forward expectantly (just waiting to see his rival lose); to hold back expectantly (waiting for a chance to strike); to be ready and available (slippers waiting by the bed); to stay in place in expectation of: to await; to remain stationary in readiness or expectation (wait for a train); to delay serving (a meal) (we’ll wait dinner for you); to pause for another to catch up —usually used with up (wait up for me)WAIVE: to put off from immediate consideration: to postponeWAIVING: to put off from immediate consideration: to postponeWAYLAY: to lie in wait for or attack (someone) from ambush
During, Duration, Passage of Time in general
AGELONG: lasting for an age: everlastingALONG: sometime within a specified or implied extent of timeAMID: during (e.g., amid the fighting)ANCIENT: having had an existence of many years; having the qualities of age or long existenceBEAT: a moment (e.g., waited a beat before responding)BLANK: a vacant or uneventful period (a long blank in history)CHRONIC: continuing or occurring again and again for a long timeCLOCK: to have a specified duration —used with in (the movie clocked in at just under 3 hours); also, to put in, to spend (time) especially at some occupation or job (clocking long hours at the office)CLOCKED: to have a specified duration —used with in (the movie clocked in at just under 3 hours); also, to put in, to spend (time) especially at some occupation or job (clocking long hours at the office)COINCIDE: to occupy the same place in space or timeCOINCIDED: to occupy the same place in space or timeCOINCIDENCE: to occupy the same place in space or timeCOINCIDING: to occupy the same place in space or timeCOMMA: a pause or intervalCRACK: moment, instant (the crack of dawn)CYCLE: a long period of time: an age; also, an interval of time during which a sequence of a recurring succession of events or phenomena is completed (a 4-year cycle of growth and development) CYCLIC: of, relating to, or being a cycle; moving in cycles (cyclic time)CYCLICAL: of, relating to, or being a cycle; moving in cycles (cyclic time)CYCLICALLY: of, relating to, or being a cycle; moving in cycles (cyclic time)DATE: duration (the short date of all things sweet—Rebecca P. Parkin)DEEP: far on: late (danced deep into the night)DILATION: an increase in duration of an event due to the effects of special relativityDRAG: to protract (drag a story out)DRAGGING: to protract (drag a story out)DURING: throughout the duration of, or at a point in the course ofFLEW: to move, pass, or spread quickly (time flew quickly)FLOWN: to move, pass, or spread quickly (time flew quickly)GOING: present participle of to go, (of time): to slip away: to elapse (The evening went quickly.)GONE: past participle of to go, (of time): to slip away: to elapse (The evening went quickly.)GRAY: to become gray; to ageGRAYING: to become gray; to ageHANG: [of time:] to be burdensome or oppressive (Time hangs on his hands.)HANGING: [of time:] to be burdensome or oppressive (Time hangs on his hands.)HIATAL : of, relating to, or involving a hiatus, an interruption in time or continuity: break, especially: a period when something (such as a program or activity) is suspended or interruptedHUNG: [of time:] to be burdensome or oppressive (Time hangs on his hands.)LENGTH: duration or extent in time; also, the quality or state of being long (the length of the journey)LENGTHY: protracted excessively: overlong; extended, longLIFE: the period of duration, usefulness, or popularity of something (the expected life of the batteries); the period of existence (as of a subatomic particle); the period from an event until death (a judge appointed for life); also, (adj.) lifelong (a life member)LIFELONG: lasting or continuing through life; long-standingLIFETIME: lifelong; of long duration or continuance; measured or achieved over the span of a career (a baseball player's lifetime batting average); the period of duration, usefulness, or popularity of something; also, the duration of the existence of a living being (such as a person or an animal) or a thing (such as a star or a subatomic particle)LITTLE: short in duration: brief (there is little time left.); rarely, infrequently; a short time (We sat and rested for a little)LIVE: to pass through or spend the duration ofLIVED: to pass through or spend the duration ofLIVING: to pass through or spend the duration ofLONG: a long period of time; extending over a considerable time (a long friendship); having a specified duration (two hours long); prolonged beyond the usual time (a long look); for or during a long time (long a popular hangout); for the duration of a specified period (month-long, all summer long)MEANTIME: during the intervening time; at the same timeMINI: of short length or duration: briefMOMENT: a minute portion or point of time: an instant; a comparatively brief period of timeMONTH: months plural: an indefinite usually extended period of time (he has been gone for months)MOON: an indefinite usually extended period of time (a labor of many moons)MUCH: by or for a long timeNEXT: immediately adjacent (as in place, rank, or time); in the time, place, or order nearest or immediately succeeding; on the first occasion to come (when next we meet)NIGH: near in place, time, or relationship OVER: throughout, during (over the past 25 years)PATCH: a period of time: a spell (was going through a rough patch)PENDING: duringPROTRACT: to prolong in time or space: to continuePROTRACTOR: one that protracts: to prolong in time or space: to continuePUNCTUATE: to break into or interrupt at intervalsPUNT: to defer (something) indefinitely; to table; to defer a decision about something —often used with on (to punt on a decision)RHYTHM: movement, fluctuation, or variation marked by the regular recurrence or natural flow of related elements (the rhythms of country life)ROLL: [of time] to move onward or around as if by completing a revolution: to elapse, pass (the months roll on)ROUND: from beginning to end: through (Holly stays green all year round.); a period of time that recurs in a fixed pattern (the daily round)RUNNING: (adj) made during the course of a process or activity (a running commentary on the game); also, to have a specified duration (The movie ran over two hours.)TAKE: to use up (space, time, etc.) (takes a long time to dry) (it takes up room)TAKEN: to use up (space, time, etc.) (takes a long time to dry) (it takes up room)TEDIUM: a tedious period of timeTEMP: short for temporaryTHROUGH: —used as a function word to indicate a period of time: such as during the entire period of (all through her life); from the beginning to the end of (slept through the movie); to and including (Monday through Friday)THROUGHOUT: during the whole course or period of (troubled her throughout her life); during the whole time or action: from beginning to endTICK: the time taken by the tick of a clock: a momentTIGHT: barely allowing time for completion (a tight schedule, tight deadlines)TIGHTLY: barely allowing time for completion (a tight schedule, tight deadlines)TIME: finite as contrasted with infinite duration; also, the measured or measurable period during which an action, process, or condition exists or continues: duration; also, recording time; also, to determine or record the time, duration, or rate of (time a horse, time the baking); also, a historical period: an age; also, a lifetime; a season; a period during which something is used or available for use (computer time); also, leisure (time for reading)TIMED: to determine or record the time, duration, or rate of (time a horse, time the baking)TIMING: to determine or record the time, duration, or rate of (time a horse, time the baking)TOOK: to use up (space, time, etc.) (takes a long time to dry) (it takes up room)TRACT: extent or lapse of timeTRACT: extent or lapse of timeTWINKLE: the instant's duration of a wink: a twinklingUNTIL: —used as a function word to indicate continuance (as of an action or condition) to a specified time (stayed until morning)UPTIME: time during which a piece of equipment (such as a computer) is functioning or able to functionWEEKLONG: lasting a weekWENT: past tense of to go, (of time): to slip away: to elapse (The evening went quickly.)WHEN: at or during the time that: whileWHILE: a period of time especially when short and marked by the occurrence of an action or a condition: a time (stay here for a while); during the time that (take a nap while I'm out); as long as (while there's life there's hope)WINDOW: an interval of time during which certain conditions or an opportunity exists (a window of vulnerability)WINK: the time of a wink: a instant (quick as a wink)WITHIN: before the end of (gone within a week)WORKDAY: the period of time in a day during which work is performed
Future
ANON: soon, presently; also, after a while: laterAWAY: distant in time (the season is two months away)EXPECT: to anticipate or look forward to the coming or occurrence of (we expect them any minute now)FORTH: onward in time, place, or order: forwardFROM: used as a function word to indicate a starting point (e.g., from this point in time)HANG: to be imminent: to impendHANGING: to be imminent: to impendHENCE: from this time (four years hence)HUNG: to be imminent: to impendIMMINENCE: the quality of being imminent, about to happenIMMINENT: ready to take place: happening soonIMMINENTLY: ready to take place: happening soonIMPEND: to be about to occurIMPENDED: to be about to occur IMPENDING: to be about to occur; also, (adj.) occurring or likely to occur soon: upcomingLONG: extending far into the future (the thoughts of youth are long, long thoughts —H. W. Longfellow)OFFING: the near or foreseeable future (in the offing)ONCOMING: future (looked forward to his oncoming visit); also, coming nearer in time or space (the oncoming year, an oncoming car)OUTLOOK: the prospect for the future OVER: until the end of (stay over Sunday)PENDING: imminent, impendingTOMORROW: the future (the world of tomorrow)TONIGHT: on this present night or the night following this present day: the present night or the night following this present dayUNBORN: still to appear: futureVIEW: the foreseeable future (no hope in view)WILL: —used to express futurity (Tomorrow I will wake up in paradise)
Geologic Time
AEON: M-W: chiefly British spelling of EON: a very large division of geologic time usually longer than an era; a unit of geologic time equal to one billion yearsEPOCH: a division of geologic time less than a period and greater than an ageGLACIAL: of, relating to, or being any of those parts of geologic time from Precambrian onward when a much larger portion of the earth was covered by glaciers than at present; PleistoceneGLACIALLY: of, relating to, or being any of those parts of geologic time from Precambrian onward when a much larger portion of the earth was covered by glaciers than at present; PleistoceneGLACIOLOGY: any of the branches of science dealing with snow or ice accumulation, glaciation, or glacial epochsTIME: a division of geologic chronology
Past not history
BACK: in or into the past: backward in time (looking back on her youth; met him in the street two days back; bad weather set the launch date back several days)BACKWARD: toward the past; the part behind or past (… the dark backward … of time …—Shakespeare)BYGONE: gone by; pastDONE: gone by: over (The day of the circus big top is done.)HIGH: long past: remote (high antiquity)LATE: not long ago: recently (a writer late of Chicago); also, being something or holding some position or relationship recently but not now (the late belligerents)LATELY: of late: recentlyOLDEN: of or relating to a bygone eraONCE: at any one time: under any circumstances: ever; also, at some indefinite time in the past: formerly; that once was: formerONETIME: former, sometime (a onetime actor); formerlyONLY: as recently as: not before (it was there only last week); in the immediate past (only just talked to her)THEN: soon after that: next in order of time (walked to the door, then turned); following next after in order of position, narration, or enumeration: being next in a series (first came the clowns, and then came the elephants)TIMELINE: an arrangement or occurrence (as of past events) in time: a chronology; also, a visual representation of events associated with a particular period of time arranged chronologically along a line or in a linear formatWHEN: at a former and usually less prosperous time (brag fondly of having known him when.)
Present
ARRIVING: to be near in time: to come (The moment has arrived.) BANG: adverb: right, directly (ran bang up against more trouble)EVEN: at the very time (raining even as the sun came out)FORTHWITH: without any delay: immediatelyGIVE: slang: to be happening (wants to know what gives)GIVEN: immediately present in experienceIMMEDIACY: the quality or state of being immediate: occurring, acting, or accomplished without loss or interval of time: instantIMMEDIATE: occurring, acting, or accomplished without loss or interval of time: instantMOMENT: the present time (at the moment)NONCE: the time beingONCE: at the moment when: as soon as (Once she spoke, I recognized her.)POINT: an exact moment (at this point I was interrupted)PROMPTLY: in a prompt manner: without delay: very quickly or immediately; exactly at a particular time or the correct time (they arrived promptly at noon)PRONTO: without delayRIGHT: in the exact moment: precisely (do it right now; quit right then); without delay: immediately (right after lunch)RUNNING: to be current: to circulate (speculation ran rife)TIME: the present time (issues of the time)TIMELY: coming early or at the right time (a timely decision, timely payment); in time: opportunelyTODAY: on or for this day; at the present timeTOMORROW: on or for the day after today; the day after the presentTONIGHT: on this present night or the night following this present day: the present night or the night following this present day
Timepieces and Horology
ANALOG: of a timepiece: having both hour and minute handsBALANCE: an oscillating wheel operating with a hairspring to regulate the movement of a timepieceBEAT: one swing of the pendulum or balance of a timepieceBEZEL: a rim that holds a transparent covering (as on a watch, clock, or headlight) or that is rotatable and has special markings (as on a watch)CLOCK: a device other than a watch for indicating or measuring time commonly by means of hands moving on a dial; broadly: any periodic system by which time is measured; also, to time with a stopwatch or by an electric timing device; to be timed atCLOCKED: a device other than a watch for indicating or measuring time commonly by means of hands moving on a dial; broadly: any periodic system by which time is measured; also, to time with a stopwatch or by an electric timing device; to be timed atCLOCKWORK: the machinery (such as springs and a train of gears) that run a clock; also: a similar mechanism running a mechanical device (such as a toy)DIAL: the face of a sundial; also, the graduated face of a timepieceDIGITAL: providing a readout in numerical digits (e.g., a digital watch/clock)FOBS: fob: a watch pocket, a small pocket just below the front waistband of men's trousersGAIN: of a timepiece: to run fastGAINED: of a timepiece: to run fastGAINING: of a timepiece: to run fastGNOMON: an object that by the position or length of its shadow serves as an indicator especially of the hour of the day: such as the pin of a sundial, or a column or shaft erected perpendicular to the horizonGONG: a wire rod wound in a flat spiral for sounding the time or chime or alarm (as in a clock)GONGED: of a clock: made the sound of a gong, a wire rod wound in a flat spiral for sounding the time or chime or alarm (as in a clock)GONGING: of a clock: making the sound of a gong, a wire rod wound in a flat spiral for sounding the time or chime or alarm (as in a clock)HAND: an indicator or pointer on a dial (e.g., the hands of a clock)HOROLOGIC: of or relating to horologe or horology, the science of measuring time, also, the art of making instruments for indicating timeHOROLOGY: the science of measuring time, also, the art of making instruments for indicating timeLOUPE: a small magnifier used especially by jewelers and watchmakersLUNAR: of time, measured by the moon's revolutionPALLET: a lever or surface in a timepiece that receives an impulse from the escapement wheel and imparts motion to a balance or pendulumPENDULUM: a body suspended from a fixed point so as to swing freely to and fro under the action of gravity and commonly used to regulate movements (as of clockwork)TICKTOCK: the ticking sound of a clockTIME: any of various systems (such as a sidereal or solar system) of reckoning time; also, a moment, hour, day, or year as indicated by a clock or calendar (what time is it); also, to regulate (a watch) to keep correct time; also, to cause to keep time with somethingTIMED: any of various systems (such as a sidereal or solar system) of reckoning time; also, a moment, hour, day, or year as indicated by a clock or calendar (what time is it); also, to regulate (a watch) to keep correct time; also, to cause to keep time with somethingTIMEPIECE: a device (such as a clock or watch) to measure or show progress of time, especially: one that does not chimeTIMING: any of various systems (such as a sidereal or solar system) of reckoning time; also, a moment, hour, day, or year as indicated by a clock or calendar (what time is it); also, to regulate (a watch) to keep correct time; also, to cause to keep time with somethingTOCK: M-W does not have this definition, from Collins: in British English: the sound made by a clock; also, to make the sound characteristic of a clock (There was silence in the kitchen except for the deep tock of the clock in the hall.)WATCH: a portable timepiece designed to be worn (as on the wrist) or carried in the pocketWIND: to tighten the spring of (wind a clock); also, an act of winding: the state of being woundWINDING: to tighten the spring of (wind a clock); also, an act of winding: the state of being wound; ; also, the act of one that winds; the manner of winding somethingWOUND: to tighten the spring of (wind a clock); also, an act of winding: the state of being wound
Times and Time Periods day, night, seasons, etc.
AEON: M-W: chiefly British spelling of EON: an immeasurably or indefinitely long period of time: an age; a very large division of geologic time usually longer than an era; a unit of geologic time equal to one billion yearsANNUAL: covering the period of a year; occurring or happening every year or once a year: yearly; also, an event that occurs yearlyANNUALLY: covering the period of a year; occurring or happening every year or once a year: yearlyAURORA: dawnAURORAL: having to do with dawnAUTUMN: the season between summer and winter comprising in the northern hemisphere usually the months of September, October, and November or as reckoned astronomically extending from the September equinox to the December solstice; called also fallAUTUMNAL: the season between summer and winter comprising in the northern hemisphere usually the months of September, October, and November or as reckoned astronomically extending from the September equinox to the December solstice; called also fallBIANNUAL: occurring twice a year; also, biennial, occurring every two years BIENNIA: plural of biennium, a period of two yearsBIENNIAL: occurring every two years (a biennial celebration); also, continuing or lasting for two years BIENNIUM: a period of two yearsCIRCADIAN: being, having, characterized by, or occurring in approximately 24-hour periods or cycles (as of biological activity or function)DAILY: covering the period of or based on a day DARK: night, nightfall (get home before dark)DAWN: the first appearance of light in the morning followed by sunrise; to begin to grow light as the sun risesDAWNED: the first appearance of light in the morning followed by sunrise; to begin to grow light as the sun risesDAWNING: the first appearance of light in the morning followed by sunrise; to begin to grow light as the sun risesDAYTIME: the time during which there is daylightDECADE: a period of 10 yearsDEPTH: the middle of a time (such as a season) (the depths of winter)DUTY: a period of being on duty (report for duty at 7 a.m.)EVENING: the latter part and close of the day and early part of the night; the period from sunset or the evening meal to bedtimeEVENTIDE*: the time of evening: eveningFALL: the season when leaves fall from trees: autumnFALLS: the season when leaves fall from trees: autumnHALF: half an hour, used in designation of time (e.g. half past two)HORAL*: relating to an hour or hours; hourlyHOUR: the 24th part of a day: 60 minutes; also, the time of day reckoned in two 12-hour periods; also, hours plural: the time reckoned in one 24-hour period from midnight to midnight … (4:30 p.m. is called 1630 hours)HOURLONG: or more commonly hour-long, lasting an hourINTRADAY: occurring in the course of a single dayLIGHT: daylight (we’ll leave when it’s light); dawnMATUTINAL: of, relating to, or occurring in the morning: earlyMIDDAY: the middle of the dayMIDMONTH: Not in M-W or NOAD; Collins has midmonth: in British English the middle of the monthMILLENNIA: plural of millennium, a period of 1000 years, especially: one reckoned from the beginning of the Christian era (the third millennium)MILLENNIAL: of or relating to a millennium, a period of 1000 years, especially: one reckoned from the beginning of the Christian era (the third millennium)MONTH: a measure of time corresponding nearly to the period of the moon's revolution and amounting to approximately 4 weeks or 30 days or ¹/₁₂ of a yearMONTHLONG: lasting a monthMONTHLY: once a month: by the month; lasting a month; of or relating to a month; occurring or appearing every monthMORN: dawn, morningMORNING: dawn; the time from sunrise to noon; the time from midnight to noonMORROW: the next dayNIGHT: the time from dusk to dawn when no sunlight is visible; the beginning of darkness: nightfall; of, relating to, or associated with the night (night air); intended for use at night (a night lamp); existing, occurring, or functioning at night (night baseball, a night nurse); active or functioning best at night (night people, night birds)NIGHTLY: at or by night; happening, done, or used by night or every night; of or relating to the night or every nightNIGHTTIME: the time from dusk to dawnNITE: used as a simplified spelling of night, the time from dusk to dawnNOON: midday; specifically: 12 o'clock at middayNOONDAY: noon; midday; the middle of the dayNOONTIDE*: noontime; the time of noon: middayOCTAVE: an 8-day period of observances beginning with a festival dayTEATIME: the customary time for tea: late afternoon or early eveningTODAY: the present day, time, or age; of or characteristic of today: nowTOMORROW: the day after today; the day after the presentTONIGHT: on this present night or the night following this present day: the present night or the night following this present dayTWILIGHT: a time of twilightWATCH: any of the definite divisions of the night made by ancient peoples; also, one of the indeterminate intervals marking the passage of night —usually used in plural (the silent watches of the night)WEEK: any of a series of 7-day cycles used in various calendars, especially: a 7-day cycle beginning on Sunday and ending on Saturday; also, any seven consecutive days; also, a series of regular working, business, or school days during each 7-day periodWHET: a time, a while (perhaps from the dialectical whet, a spell of work done with a scythe between the time it is sharpened and the time it needs to be sharpened again)
Spelling Bee words related to TIME
ABIDEABIDEDABIDINGADJOURNADVANCEADVANCEDAEONAGELONGALONGAMIDANALOGANCIENTANNUALANNUALLYANONANTEDATEANTEDATEDANYTIMEARRIVINGAURORAAURORALAUTUMNAUTUMNALAWAITAWAYBACKBACKWARDBALANCEBALKY BANGBEATBELATE*BELATEDLYBEZELBIANNUALBIDEBIDEDBIDINGBIENNIABIENNIAL BIENNIUMBLANKBODEBYGONECHECKCHRONICCIRCADIANCIVILCLOCKCLOCKEDCLOCKWORKCOINCIDECOINCIDEDCOINCIDENCECOINCIDINGCOLONCOMMACOUNTDOWNCRACKCRANINGCYCLECYCLICCYCLICALCYCLICALLYDAILYDARKDATEDATEDDATINGDAWNDAWNEDDAWNINGDAYTIMEDECADEDEEPDELAYDELAYABLEDELAYEDDEPTHDIALDIGITALDILATIONDONEDRAGDRAGGINGDURINGDUTYDWELLDWELLEDDWELLINGDWELTEPOCHEVENEVENINGEVENTIDE* EVEREXPECTFALLFALLSFINALLYFLEWFLOWNFOBSFORTHFORTHWITHFROMGAINGAINEDGAININGGIVEGIVENGLACIALGLACIALLYGLACIOLOGYGNOMONGOINGGONEGONGGONGEDGONGINGGRAYGRAYINGHALFHANDHANGHANGINGHENCEHIATAL HIGHHORAL*HOROLOGICHOROLOGYHOURHOURLONGHUNGIMMEDIACYIMMEDIATEIMMINENCEIMMINENTIMMINENTLYIMPENDIMPENDED IMPENDING
INFINITEINFINITUDEINFINITYINTOINTRADAYINTROLATELATELYLATENLENGTHLENGTHYLIFELIFELONGLIFETIMELIGHTLITTLELIVELIVEDLIVINGLONGLOUPELUNARMATUTINALMEANTIMEMIDDAYMIDMONTHMILLENNIAMILLENNIALMINIMOMENTMONTHMONTHLONGMONTHLYMOONMORATORIAMORNMORNINGMORROWMUCHNEXTNIGHNIGHTNIGHTLYNIGHTTIMENITENONCENOONNOONDAYNOONTIDE*OCTAVEOFFINGOLDENONCEONCOMINGONETIMEONLYOUTLOOK OVERPAGEPALLETPATCHPENDINGPENDINGPENDULUMPOINTPRIORPROMPTLYPRONTOPROTRACTPROTRACTORPUNCTUATEPUNTQUEUEQUEUEDQUEUEINGQUEUINGRHYTHMRIGHTROLLROUNDRUNNINGTAKETAKENTARDYTARRYTARRYINGTEATIMETEDIUMTEMPTHENTHROUGHTHROUGHOUTTICKTICKTOCKTIGHTTIGHTLYTILLTIMETIMEDTIMELINETIMELYTIMEPIECETIMEZONETIMINGTOCKTODAYTOMORROWTONIGHTTOOKTRACTTURNTWEENTWILIGHTTWINKLEUNBORNUNTILUNTOUPTIMEVIEWVIGILWAITWAIVEWAIVINGWATCHWAYLAYWEEKWEEKLONGWENTWHENWHETWHILEWILLWINDWINDINGWINDOWWINKWITHINWORKDAYWOUND
LexiConnexxions New York Times Spelling Bee answers analysis statistics peregrine
If you cite information from LexiConnexxions, please give credit and a link to the relevant page. These reports and analyses are conceived, compiled, designed, and prepared by a human being, not a machine. This website is 100% AI-free; it is conceived, designed, written, and maintained by a human being. Except where noted, all content ©2022-2026 and in perpetuity by LexiConnexxions. All rights reserved. Dissemination, re-use, or duplication by any means, for any purpose whatsoever, is prohibited except by express written permission of LexiConnexxions. This site is not affiliated with The New York Times or with any other sites related to the New York Times Spelling Bee. Contact LexiConnexxions at info // @ // lexiconnexxions.com.