LexiConnexxions
  • Home
    • Contact
  • The Lexicon
    • Bee Words with Histories
    • The Midden: Discontinued Bee Words
    • IN-OUT Words
    • OUT-IN Words
    • IN-OUT-IN Words
    • OUT-IN-OUT Words
    • FLIP-FLOP Words
    • Pangrams with Checkered Histories
    • Pangram Ratios to Word Counts
    • 2025 Annual Summary
    • 2024 Annual Summary
    • 2023 Annual Summary
    • 2026 Jul Summary
    • 2026 Jun Summary
    • 2026 May Summary
    • 2026 Apr Summary
    • 2026 Mar Summary
    • 2026 Feb Summary
    • 2026 Jan Summary
    • 2025 Dec Summary
    • 2025 Nov Summary
    • 2025 Oct Summary
    • 2025 Sep Summary
    • 2025 Aug Summary
    • 2025 Jul Summary
    • 2025 Jun Summary
    • 2025 May Summary
    • 2025 Apr Summary
    • 2025 Mar Summary
    • 2025 Feb Summary
    • 2025 Jan Summary
    • 2024 Dec Summary
    • 2024 Nov Summary
    • 2024 Oct Summary
    • 2024 Sep Summary
    • 2024 Aug Summary
    • 2024 Jul Summary
    • 2024 Jun Summary
    • 2024 May Summary
    • 2024 Apr Summary
    • 2024 Mar Summary
    • 2024 Feb Summary
    • 2024 Jan Summary
    • 2023 Dec Summary
    • 2023 Nov Summary
    • 2023 Oct Summary
    • 2023 Sep Summary
    • 2023 Aug Summary
    • 2023 Jul Summary
  • Reports & Records
    • Bees of Special Interest
    • 2500th Spelling Bee
    • Goofs and Gaffes
    • All Letters in Bee History
    • Bees with Only One Vowel
    • Bees with J Q S X Z
    • Bees with Letter S
    • Bees with I+N+G and/or E+D
    • Center Letters in Bee History
    • Starting Letters Center Letter Only
    • Starting Letters No Center Letter
    • Starting Letters Fewest
    • Starting Letters No Vowels
  • LexiTopics
    • About the LexiTopics Project
    • The LexiTopics Taxonomy
    • Agriculture & Farm Life
    • Animals
    • Astronomy
    • Attire Fashion & Style
    • Aviation & Aircraft
    • Belief Systems
    • Biology
    • Botanicals
    • Buildings Architecture & Construction
    • Business & Commerce
    • Chemistry
    • Colors
    • Conditions & Characteristics
    • Dance
    • Dramatic Arts
    • Economics & Finance
    • Energy Light Sound Heat
    • Engineering
    • Entertainment Hospitality & Service
    • Environment Habitat & Nature
    • Events & Incidents
    • Existence & Change
    • Food & Drink
    • Furnishings & Fitments
    • Games Toys & Play
    • Geology & Geography
    • Government Civics & Politics
    • History & Olden Times
    • Human Anatomy
    • Human Health & Medicine
    • Information & Communication Technologies
    • Intoxicants
    • Knowledge & Information
    • Law Crime & Courts
    • Learning Education & Research
    • Machines Tools & Devices
    • Manufacturing Products & Packaging
    • Mathematics
    • Matter & Materials
    • Measures & Measurements
    • Motions: Actions & Operations
    • Motions: Coming & Going
    • Motions: Movements
    • Music
    • Myth & Magic
    • Nautical & Maritime
    • Numbers
    • Objects & Collections
    • Occupations
    • People: Character & Appearance
    • People: Efforts & Endeavors
    • People: Emotion & Affect
    • People: Engagement & Interaction
    • People: Individuals & Groups
    • People: Movements & Motions
    • People: Thought & Comprehension
    • Physics
    • Places & Spaces
    • Possession Use & Disposal
    • Quantity Extent Size & Degree
    • Shapes & Textures
    • Speech & Verbal Expression
    • Sports & Recreation
    • Textiles Fibers & Needlecrafts
    • Time
    • Transportation & Travel
    • Visual Arts
    • Weapons & Warfare
    • Weather & Climate
    • Words & Language
    • Writing & Publishing
  • WordPlay
    • Etymologies Brand Names
    • Etymologies Eponyms
    • Etymologies Literary & Film References
    • Etymologies Portmanteaux & Blend-Words
    • Etymologies Toponyms
    • Rogues Offensive
    • Spelling Counts Abandoned Accents
    • Spelling Counts Abbreviations etc.
    • Spelling Counts Clipped Words & Phrases
    • Spelling Counts Palindromes
    • Spelling Counts Reductions Contractions
    • Spelling Counts WORDZ
    • Topics Alphabet Soup
    • Topics Chemical Elements
    • Topics ILLIONs TEENs & NTHs
    • Topics OLOGIES
    • Topics Personal Names
    • Topics State Birds
    • Topics Vehicle Makes & Models
    • Solver List ABLE IBLE
    • Solver List AUGH EIGH IGH OUGH
    • Solver List CATS AND DOGS
    • Solver List -EE
    • Solver List -FUL-
    • Solver List NYMs
    • Solver List WOMAN MAN GIRL BOY
    • Solver List WOOD WIND WILD
    • Wanderings GIRD
    • Wanderings JECT
    • Wanderings MOTORWAY
  • Gameplay
    • The Puzzle Page
    • Entering Words in the Puzzle
    • Ranks and Scoring
    • The Official Hints Page
    • Pangrams and Bingo
    • Solv-ING Tips
    • Looking Up Bee Words
    • Navigating the Forum
    • Participating in the Forum
    • Beeatrice
  • Resources
    • Spelling Bee Dictionaries
    • Spelling Bee Info from NYT
    • Spelling Bee Editor
    • Spelling Bee Community
    • NYT Games Info from NYT
    • Spelling Bee in the News
    • Spelling Bee Research & Data
    • Spelling Bee Transcripts

LexiTopic: Manufacturing, Products, and Packaging

If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to MANUFACTURING, PRODUCTS, AND PACKAGING in the Spelling Bee lexicon. The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Click HERE to learn more about the LexiTopics analysis project, including origins, methodology, process, and more.
Click HERE to jump to the LexiTopics main page, with links to the dozens of LexiTopics Reports.
Click HERE to see the entire LexiTopics Taxonomy, the subject list that was developed exclusively for this analysis.
Taxonomy for Spelling Bee words related to MANUFACTURING, PRODUCTS, AND PACKAGING
SUBJECT HEADINGS IN THIS LEXITOPIC: Containers and PackagingLeather, Fur, and Fleece productsLumbering and Wood ProductsManufacturing Facilities and PlacesManufacturing Materials and ProcessesMetallurgyMines and MiningPaper and Plastic Products
NOTES ABOUT THE TAXONOMY FOR MANUFACTURING AND PRODUCTS SCOPE NOTE: This LexiTopic compiles and defines Bee words related to manufacturing processes and facilities, certain classes of products, and packaging. Words related to non-lumbering aspects of wood and trees are in BOTANICALS. Words related to filling and emptying [any sorts of containers] are in PLACES AND SPACES. Words related to actions done to matter or objects are (in general) in MOTIONS: ACTIONS AND OPERATIONS.
Topical arrangement of Spelling Bee words related to MANUFACTURING, PRODUCTS, AND PACKAGING
Containers and Packaging
AIRTIGHT: impermeable to air or nearly so BAGGED: to put into a bagBAGGIE: a usually small, clear plastic bag; M-W does not give word origin; Collins says from “Baggies, a trademark for such bags”BAGGING: to put into a bagBAGGING: material (such as cloth) for bagsBAIL: a container used to remove water from a boatBILGE: the bulging part of a cask or barrelBINNED: put in a binBINNING: put in a binBOAT: a boat-shaped container, utensil, or device (e.g., a gravy boat)BOMB: a container for an aerosol (such as an insecticide): a spray can; also, a lead-lined container for radioactive materialBOTTLE: a rigid or semirigid container typically of glass or plastic having a comparatively narrow neck or mouth and usually no handle; also, a usually bottle-shaped container made of skin for storing a liquidBOXING: a boxlike enclosure: casing; also, material used for boxes and casings; also, an act of enclosing in a box; also, to enclose in or as if in a boxBUNG: the stopper especially in the bunghole of a caskBUTT: a large cask especially for wine, beer, or waterCADDY: a container or device for storing or holding objects when they are not in use; also, a small box, can, or chest used especially to keep tea inCAPPED: to provide or protect with a cap (cap a bottle)CAPPING: to provide or protect with a cap (cap a bottle)CATCH: to take in and retain (a barrel to catch rainwater)CATCHALL: something that holds or includes odds and ends or a wide variety of thingsCHIME: the edge or rim of a cask or drumCONTENT: something contained —Used in plural (the jar's contents, the drawer’s contents)CORK: a usually cork stopper for a bottle or jug; also, to furnish or fit with cork or a cork; to stop up with a corkCORKING: a usually cork stopper for a bottle or jug; also, to furnish or fit with cork or a cork; to stop up with a corkCROCK: a thick earthenware pot or jarCUPPING: to place in or as if in a cupEMPTY: (noun) something (such as a bottle or can) that is emptyFORTY: or 40 US, informal: a forty-ounce bottle or other container of an alcoholic beverage (such as beer or malt liquor)FUNNEL: a utensil that is usually a hollow cone with a tube extending from the smaller end and that is designed to catch and direct a downward flowHOOP: a circular strip used especially for holding together the staves of containers; also, to bind or fasten with or as if with a hoopHOOPED: a circular strip used especially for holding together the staves of containers; also, to bind or fasten with or as if with a hoopHOOPING: a circular strip used especially for holding together the staves of containers; also, to bind or fasten with or as if with a hoopHORN: a hollow horn used to hold somethingLIDDED: having or covered with a lid (a lidded tureen); also, having lids especially of a specified kind —usually used in combination (heavy-lidded); also, to cover or supply with a lidLONGNECK: a beer bottle that has a long neckMAGNUM: a large wine bottle holding about 1.5 litersMORTAR: a sturdy vessel in which material is pounded or rubbed with a pestleMOUTH: the opening of a container (the mouth of a bottle)NECK: the constricted end of a bottleOPEN: not covered with a top, roof, or lid (an open car; the jar was open)PACK: a container; also, to put in a container (goods packed for shipment); also, a number of individual components packaged as a unit (a pack of gum)PACKABLE: to put in a container (goods packed for shipment)PACKED: a container; also, to put in a container (goods packed for shipment)PADDED: to furnish with a pad or paddingPADDING: to furnish with a pad or padding; also, material with which something is paddedPAIL: a usually cylindrical container with a handle: bucketPANNED: to place in a panPANNING: to place in a panPEANUT: a pellet made of a low-density lightweight material (such as polystyrene foam or corn starch) that is used especially as packing material —usually pluralPHIAL: a vial, a small closed or closable vessel especially for liquids [M-W has a separate entry for PHIAL, defined as and directing to what seems to be the preferred spelling of VIAL, with no indication that PHIAL is a variant of VIAL]PINT: a pint pot or vesselPLUG: a piece used to fill a hole: a stopper; also, to stop, make tight, or secure by inserting a plug; to remedy (a deficiency) as if by inserting a plug (trying to plug the gaps in their understanding); also, to become plugged —usually used with upPOCKET: a receptacle, a containerPORT: a small opening in a container or vessel especially for viewing or for the controlled passage of material (access port)POTTED: to place in a potPOTTING: to place in a potPUNT: a concave indentation in the bottom of a wine bottleQUART: a vessel or measure having a capacity of one quartRAFFIA: the fiber of the raffia palm used especially as cord for tying and weavingROLL: a quantity (as of fabric or paper) rolled up to form a single package (a roll of paper towels); also, a paper tube that holds something (as candies or coins) (a roll of quarters); also, to put a wrapping around: to enfold, envelop (rolled the material in plastic wrap)TALLBOY: or tall boy: a tall cylindrical can for beverages (such as beer) usually measuring 16 fluid ouncesTANK: a usually large receptacle for holding, transporting, or storing liquids (such as water or fuel); also, to place, store, or treat in a tankTRAY: an open receptacle with a flat bottom and a low rim for holding, carrying, or exhibiting articlesTROUGH: any of various domestic or industrial containersTUBE: a soft tubular container whose contents (such as toothpaste) can be removed by squeezingVIAL: a small closed or closable vessel especially for liquids [M-W has a separate entry for PHIAL, defined as and directing to what seems to be the preferred spelling of VIAL, with no indication that PHIAL is a variant of VIAL]WRAP: a wrapper or wrapping: that in which something is wrapped; also, material used for wrapping (plastic wrap); also, to envelop and secure for transportation or storage: to bundle; to enclose as if with a protective covering; to be subject to covering, enclosing, or packaging —usually used with up; to enclose as if with a protective coveringWRAPPING: something used to wrap an object: a wrapper; also, a wrapper or wrapping: that in which something is wrapped; also, material used for wrapping (plastic wrap); also, to envelop and secure for transportation or storage: to bundle; to enclose as if with a protective covering; to be subject to covering, enclosing, or packaging —usually used with up; to enclose as if with a protective coveringYARD: a slender glass about three feet tall having a flared opening and a bulbous bottom; also: the amount it contains (a yard of ale)
Leather, Fur, and Fleece products
ALLIGATOR: leather made from alligator hideALPACA: wool of the alpaca, a domesticate mammal (Vicugna pacos synonym Lama pacos) especially of Peru that is probably descended from the vicuña; or a thin cloth made of or containing this wool, or a rayon or cotton imitation of this clothANGORA: the hair of the Angora rabbit or Angora goat, or a yarn of Angora rabbit hair used especially for knitting. (In the names of animals -- Angora cat, Angora rabbit, Angora goat – the adjective is proper.) From Ankara (historically known as Angora), in present-day Turkey.BELLY: the undersurface of an animal's body; also: hide from this partBUCK: buckskin, the skin of a buck: a soft pliable usually suede-finished leather, such as used for making garments, shoes, etc.BUFF: a device having a soft absorbent surface (as of cloth) by which polishing material is applied; also, to give a velvety surface to (as to leather) [by buffing]BUFFED: a device having a soft absorbent surface (as of cloth) by which polishing material is applied; also, to give a velvety surface to (as to leather) [by buffing]BUFFS: a device having a soft absorbent surface (as of cloth) by which polishing material is applied; also, to give a velvety surface to (as to leather) [by buffing]CALF: the hide of the domestic calf, especially: calfskinCAMEL: leather made from the skin of a camel, either of two large ruminant mammals (genus Camelus) that have one or two large humps of stored fat on the back and are used as draft and saddle animals in desert regions especially of Africa and AsiaCHINCHILLA: the fur of the chincilla, either of two small South American rodents (Chinchilla laniger and C. brevicaudata of the family Chinchillidae) of the high Andes that are the size of large squirrels, have very soft pearly-gray fur, and are extensively bred in captivityCLIP: the product of a single shearing (as of sheep); also, a crop of wool of a sheep, a flock, or a regionCOON*: short for raccoon, the pelt of the racoon, a small nocturnal carnivore (Procyon lotor) of North America that is chiefly gray, has a black mask and bushy ringed tail, lives chiefly in trees, and has a varied diet including small animals, fruits, and nuts; also, the pelt of this animalCORDOVAN: a soft fine-grained colored leather; a dense nonporous leather tanned from the inner layer of horsehide; also, made of cordovan leather, from Córdova, Córdoba, city in Spain where such leather was producedCRIMP: a pressed shape in leather; also, to form (leather) into a desired shapeCRIMPING: a pressed shape in leather; also, to form (leather) into a desired shapeCROC: short for crocodile, the skin or hide of a crocodile, any of several large, carnivorous, thick-skinned, long-bodied, aquatic reptiles (family Crocodylidae and especially genus Crocodylus) of tropical and subtropical waters that have a long, tapered, V-shaped snout; broadly: crocodilian, any of an order (Crocodylia) of reptiles including the crocodiles, alligators, caimans, gharials, and related extinct formsFELL: skin, hide, pelt; or a thin tough membrane covering a carcass directly under the hideFLEECE: the coat of wool covering a wool-bearing animal (such as a sheep); also, the wool obtained from a sheep at one shearing; or to shearGRAIN: the outer or hair side of a skin or hideHIDE: the skin of an animal whether raw or prepared for use —used especially of large heavy skins (buffalo killed for their hides, boots made of cow hide)LAMB: lambskin, a lamb's skin or a small fine-grade sheepskin or the leather made from either; specifically: such a skin dressed with the wool on and used especially for winter clothingLIZARD: leather made from lizard skinMINK: soft fur or pelt of the mink varying in color from white to dark brownMOCHA: a pliable suede-finished glove leather from African sheepskins; named for Mocha, YemenMOROCCO: a fine leather from goatskin tanned with sumac, from Morocco, AfricaOOZE: a decoction of vegetable material used for tanning leatherPATENT: patent leather, a leather with a hard smooth glossy surfacePELT: a usually undressed skin with its hair, wool, or fur; a skin stripped of hair or wool for tanning; also, to strip off the skin or pelt of (an animal)PELTED: a usually undressed skin with its hair, wool, or fur; a skin stripped of hair or wool for tanning; also, to strip off the skin or pelt of (an animal)PUMA: the fur or pelt of a puma, a large powerful tawny-brown cat (Puma concolor synonym Felis concolor) formerly widespread in the Americas but now reduced in number or extinct in many areas; called also catamount, mountain lion, panther, pumaRABBIT: the pelt of a rabbitRACCOON: the pelt of the racoon, a small nocturnal carnivore (Procyon lotor) of North America that is chiefly gray, has a black mask and bushy ringed tail, lives chiefly in trees, and has a varied diet including small animals, fruits, and nutsROAN: sheepskin tanned with sumac and colored and finished to imitate moroccoTALLOW: the white nearly tasteless solid rendered fat of cattle and sheep used chiefly in soap, candles, and lubricants; also, to grease or smear with tallowTANNED: to convert (hide) into leather by treatment with an infusion of tannin-rich bark or other agent of similar effect; also, to convert (protein) to leather or a similar substanceTANNIC: of, resembling, or derived from tan or a tanninTANNIN: any of various soluble astringent complex phenolic substances of plant origin used especially in tanning leather and dyeing textiles, manufacturing ink, clarifying wine and beer, and in medicine; also, a substance that has a tanning effectTANNING: the art or process by which a skin is tanned; also, to convert (hide) into leather by treatment with an infusion of tannin-rich bark or other agent of similar effect; also, to convert (protein) to leather or a similar substanceTIPPED: to blend (furs) for improved appearance by brushing the tips of the hair with dyeTIPPING: to blend (furs) for improved appearance by brushing the tips of the hair with dyeVELLUM: a fine-grained unsplit lambskin, kidskin, or calfskin prepared especially for writing on or for binding books; also, of, resembling, or bound in vellumWOLF: the fur of a wolfWOOL: the soft wavy or curly usually thick undercoat of various hairy mammals and especially the sheep made up of a matrix of keratin fibers and covered with minute scales; also, a product of wool, especially: a woven fabric or garment of such fabricWOOLEN: made of wool; of or relating to the manufacture or sale of woolen products (woolen mills)WOOLLY: resembling wool; of, relating to, or bearing woolYOLK: oily material in unprocessed sheep wool consisting of wool fat, suint, and debrisYOLKY: full of yolk: greasy —used of unwashed wool
Lumbering and Wood Products
BALK: a beam or rafterBARK: the tough exterior covering of a woody root or stemBATTEN: a thin narrow strip of lumber used especially to seal or reinforce a joint; also, to furnish with battens, or to fasten with or as if with battens, often used with downBEAM: a long piece of heavy often squared timber suitable for use in construction; also, to support with beamsBEAMED: a long piece of heavy often squared timber suitable for use in construction; also, to support with beamsBEAMING: a long piece of heavy often squared timber suitable for use in construction; also, to support with beamsBILLET: a chunky piece of wood (as for firewood)BOARD: a piece of sawed lumber of little thickness and a length greatly exceeding its width; also, to cover or seal off with lumber: to cover or seal off with boards (e.g., board up a window)BOLT: a block of timber to be sawed or cut; also, a short round section of a logBOUGH: a branch of a treeBRANCH: botany: a natural subdivision of a plant stem, especially: a secondary shoot or stem (such as a bough) arising from a main axis (as of a tree)BRAND: a charred piece of wood or a firebrand, a piece of burning wood, or something (such as lightning) that resembles a firebrandBURL: veneer made from burls (a burl is a hard woody often flattened hemispherical outgrowth on a tree)BURR: a tree burlBUTT: to trim or square off (something, such as a log) at the endBUTTED: to trim or square off (something, such as a log) at the endBUTTING: to trim or square off (something, such as a log) at the endCANT: a log with one or more squared sidesCHIP: to cut into chips (chip a tree stump)CHIPPED: to cut into chips (chip a tree stump)CHIPPING: to cut into chips (chip a tree stump)CLAVE: to split, especially along the grain, as woodCLEAVE: to split, especially along the grain, as woodCLEFT: to split, especially along the grain, as woodCORD: a unit of wood cut for fuel equal to a stack 4 x 4 x 8 feet or 128 cubic feetCURL: a curved or spiral marking in the grain of woodCURLY: having the [wood] grain composed of fibers that undulate without crossing and that often form alternating light and dark lines (as in curly maple)DEADWOOD: wood dead on the tree DEAL: pine or fir wood [used in building, furniture, etc.]FLOORBOARD: a board in a floorGNARL: a hard protuberance with twisted grain on a treeGNARLY: gnarled, as in gnarly branchesGRAIN: the stratification of the wood fibers in a piece of wood IRONWOOD: the wood of an ironwood, any of numerous trees and shrubs (such as a hornbeam or hop hornbeam) with exceptionally tough or hard woodKNAR*: M-W: variant of knaur, a knot or burl on woodKNEE: a piece of timber naturally or artificially bent for use in supporting structures coming together at an angle (such as the deck beams of a ship)KNOT: the base of a woody branch enclosed in the stem from which it arises (also: its section in lumber)KNOTHOLE: a hole in a board or tree trunk where a knot or branch has come outLATH: a thin narrow strip of wood nailed to rafters, joists, or studding as a groundwork for slates, tiles, or plaster; also, a quantity of laths; also a verb, to lath, meaning to apply lathsLATHED: a thin narrow strip of wood nailed to rafters, joists, or studding as a groundwork for slates, tiles, or plaster; also, a quantity of laths; also a verb, to lath, meaning to apply lathsLATHING: a thin narrow strip of wood nailed to rafters, joists, or studding as a groundwork for slates, tiles, or plaster; also, a quantity of laths; also a verb, to lath, meaning to apply lathsLIMB: a large primary branch of a tree; also, to cut off the limbs of (a felled tree) LINDEN: the light fine-grained white wood of a linden, especially: basswood, the straight-grained soft white wood of a basswoodLOGGED: to cut (trees) for lumber [or fuel]; also, to clear (land) of trees in lumbering —often used with offLOGGING: to cut (trees) for lumber [or fuel]; also, to clear (land) of trees in lumbering —often used with offLOGROLL: to take part in logrolling (the rolling of logs in water by treading); also: a sport in which contestants treading logs try to dislodge one anotherLOPPING: to cut off branches or twigs from; to sever from a woody plantOAKEN: made from the wood of an oak treePINE: the straight-grained white or yellow usually durable and resinous wood of a pine varying from extreme softness in the white pine to hardness in the longleaf pinePINEWOOD: the wood of the pine treePLANK: a heavy thick board, especially: one 2 to 4 inches (5 to 10 centimeters) thick and at least 8 inches (20 centimeters) wide; also, an object made of a plank or planking; also, to cover, build, or floor with planksPLANKING: the act or process of covering or fitting with planks; also, a quantity of planks; also, to cover, build, or floor with planksPOLE: a tree with a breast-high diameter of from 4 to 12 inches (10 to 30 centimeters)POLLARD*: a tree cut back to the trunk to promote the growth of a dense head of foliage; also, to make a pollard of (a tree)PUNK: wood so decayed as to be dry, crumbly, and useful for tinderRICK: a pile of material (such as cordwood) split from short logs; also, to pile (something, such as logs) in ricksRIND: the bark of a treeRING: the annual ring: the layer of wood produced by a single year's growth of a woody plantRIPPING: to saw or split (wood) with the grainRIPPLY: having ripple marks: a striation across the grain of wood especially on the tangential surfaceTEAK: also, the hard yellowish-brown wood of teak (a tall tropical Asian timber tree, Tectona grandis, of the mint family) used especially for furniture and shipbuildingTOON: a southeast Asian and Australian tree (Toona ciliata synonym Cedrela toona) of the mahogany family with aromatic dark red to reddish-brown wood; also, its woodTUPELO: any of a genus (Nyssa of the family Nyssaceae) of North American and Asian deciduous trees that have simple alternate leaves, small usually greenish-white dioecious flowers, and a rounded drupe, especially: black gum; also, the pale soft wood of a tupelo VENEER: a layer of wood of superior value or excellent grain to be glued to an inferior wood; also, any of the thin layers bonded together to form plywood; also, to overlay or plate (a surface, as of a common sort of wood) with a thin layer of finer wood for outer finish or decoration; broadly: to face with a material giving a superior surfaceWANE: a defect in lumber characterized by bark or a lack of wood at a corner or edgeWILLOW: an object made of willow woodWOOD: the hard fibrous substance consisting basically of xylem that makes up the greater part of the stems, branches, and roots of trees or shrubs beneath the bark and is found to a limited extent in herbaceous plants; also, wood suitable or prepared for some use (such as burning or building); also, something made of woodWOODEN: made or consisting of woodWOODWORK: work made of woodWORMY: damaged by worms: worm-eaten (wormy timbers)
Manufacturing Facilities and Places
BOATYARD: a yard where boats are built, repaired, and stored and often sold or rentedDOCKYARD: a shipyard, a yard, place, or enclosure where ships are built or repaired FACTORY: a building or set of buildings with facilities for manufacturingFOUNDRY: an establishment where founding is carried on; also, the act, process, or art of casting metalsIRONWORK: ironworks plural in form but singular or plural in construction: a mill or building where iron or steel is smelted or heavy iron or steel products are madeMILL: a building provided with machinery for processing and especially for grinding grain into flour; also, a building or collection of buildings with machinery for manufacturing (a paper mill, steel mills)MINT: a place where something is manufactured; also, to create, produce; to cause to attain an indicated status (newly minted doctors)PLANT: the land, buildings, machinery, apparatus, and fixtures employed in carrying on a trade or an industrial business; also, a factory or workshop for the manufacture of a particular product; also, the total facilities available for production or serviceWORK: works plural in form but singular or plural in construction: a place where industrial labor is carried on: a plant, a factoryYARD: an area with its buildings and facilities set aside for a particular business or activity (stock yard, lumber yard); also, to deliver to or store in a yard
Manufacturing Materials and Processes
ACACIA: gum arabic, a water-soluble gum obtained from several acacias (especially Senegalia senegal synonym Acacia senegal) and used especially in the manufacture of inks, adhesives, pharmaceuticals, and confectionsACID: containing or involving the use of an acid (as in manufacture) (e.g., an acid bath)ANNEAL: to heat and then cool (a material, such as steel or glass) usually for softening and making less brittleANNEALED: to heat and then cool (a material, such as steel or glass) usually for softening and making less brittleANNEALING: to heat and then cool (a material, such as steel or glass) usually for softening and making less brittleBAKE: to dry or harden by subjecting to heatBAKED: to dry or harden by subjecting to heatBAKING: to dry or harden by subjecting to heatBATH: a contained liquid for a special purpose, or a receptacle holding the liquid; also, a medium for regulating the temperature of something placed in or on it, or a vessel containing this medium BITUMEN: any of various mixtures of hydrocarbons (such as tar) often together with their nonmetallic derivatives that occur naturally or are obtained as residues after heat-refining natural substances (such as petroleum)specifically: such a mixture soluble in carbon disulfide; also, an asphalt of Asia Minor used in ancient times as a cement and mortarBOBBED: a small polishing wheel of solid felt or leather with rounded edges; also, to polish with a bob: to buffBOBBING: a small polishing wheel of solid felt or leather with rounded edges; also, to polish with a bob: to buffBOBS: a small polishing wheel of solid felt or leather with rounded edges; also, to polish with a bob: to buffBOMB: a vessel for compressed gasesBURR: a thin ridge or area of roughness produced in cutting or shaping metal; also, to form into a projecting edgeCOLD: involving processing without the use of heat (cold working of steel)COOK: to subject (something) to the action of heat or fire during preparation; a technical or industrial process comparable to cooking food; also: a substance so processedCOOKED: to subject (something) to the action of heat or fire during preparation; a technical or industrial process comparable to cooking food; also: a substance so processedCOOKING: to subject (something) to the action of heat or fire during preparation; a technical or industrial process comparable to cooking food; also: a substance so processedCOOLANT: a usually fluid cooling agentDAPPED: dap, verb: to produce (cup-shaped forms in sheet metal) by the use of special dies and punches DAPPING: dap, verb: to produce (cup-shaped forms in sheet metal) by the use of special dies and punches DIPPED: to immerse something into a processing liquid or finishing materialDIPPING: to immerse something into a processing liquid or finishing materialDOPE: a thick liquid or pasty preparation; or a preparation for giving a desired quality to a substance or surface; or to treat with dope or a dopantFEED: material supplied (as to a furnace or machine); also, a mechanism by which the action of feeding is effected; also the motion or process of carrying forward the material to be operated upon (as in a machine); also, to supply (material to be operated on) to a machine; to move into a machine or opening in order to be used or processedFEEDING: material supplied (as to a furnace or machine); also, a mechanism by which the action of feeding is effected; also the motion or process of carrying forward the material to be operated upon (as in a machine); also, to supply (material to be operated on) to a machine; to move into a machine or opening in order to be used or processedFETTLE: to cover or line the hearth of (something, such as a reverberatory furnace) with loose material (such as sand or gravel)FLANGE: to furnish with a flange, a rib or rim for strength, for guiding, or for attachment to another objectFLANGING: to furnish with a flange, a rib or rim for strength, for guiding, or for attachment to another objectFORGING: the art or process of forging, to form (something, such as metal) by heating and hammering; also, a piece of forged workFORM: a mold in which concrete is placed to setGROG: refractory materials (such as crushed pottery and firebricks) used in the manufacture of refractory products (such as crucibles) to reduce shrinkage in drying and firingHACKLE: a comb or board with long metal teeth for dressing flax, hemp, or juteHEMP: the fiber of hemp (used to produce paper and construction materials), or a fiber (such as jute) from a plant other than the true hempKILN: an oven, furnace, or heated enclosure used for processing a substance by burning, firing, or dryingKILNING*: an oven, furnace, or heated enclosure used for processing a substance by burning, firing, or drying; also, to heat in a kilnLAND: an area of a partly machined surface (such as the inside of a gun barrel) that is left without machiningLAPPED: to dress, smooth, or polish (something, such as a metal surface) to a high degree of refinement or accuracy; also, to shape or fit by working two surfaces together with or without abrasives until a very close fit is producedLAPPING: to dress, smooth, or polish (something, such as a metal surface) to a high degree of refinement or accuracy; also, to shape or fit by working two surfaces together with or without abrasives until a very close fit is producedLINE: an arrangement of operations in manufacturing permitting sequential occurrence on various stages of production (a production line)LOAD: the amount of authorized work to be performed by a machine; also, to place or insert (something) especially as a load in a device or piece of equipment; also, the quantity of material loaded into a device at one time; also, to put a load or charge in (a device or piece of equipment)LOADED: the amount of authorized work to be performed by a machine; also, to place or insert (something) especially as a load in a device or piece of equipment; also, the quantity of material loaded into a device at one time; also, to put a load or charge in (a device or piece of equipment)LOADING: the amount of authorized work to be performed by a machine; also, to place or insert (something) especially as a load in a device or piece of equipment; also, the quantity of material loaded into a device at one time; also, to put a load or charge in (a device or piece of equipment)MACHINING: to process by or as if by machine; especially: to reduce or finish by or as if by turning, shaping, planing, or milling by machine-operated toolsMANTLE: the outer wall and casing of a blast furnace above the hearth; broadly: an insulated support or casing in which something is heatedMINT: a place where something is manufactured; also, to create, produce; to cause to attain an indicated status (newly minted doctors)MINTED: a place where something is manufactured; also, to create, produce; to cause to attain an indicated status (newly minted doctors)MINTING: a place where something is manufactured; also, to create, produce; to cause to attain an indicated status (newly minted doctors)MORDANT: a corroding substance used in etching; also, to treat with a mordantRAWLY: raw: being in or nearly in the natural state: not processed or purified (raw fibers, raw sewage); RUNNING: to melt and cast in a mold (run bullets); also, to treat, process, refine (run oil in a still)TAIL: tailing: residue separated in the preparation of various products (such as grain or ores) —usually used in pluralTAILING: residue separated in the preparation of various products (such as grain or ores) —usually used in pluralTANNIC: of, resembling, or derived from tan or a tanninTANNIN: any of various soluble astringent complex phenolic substances of plant origin used especially in tanning leather and dyeing textiles, manufacturing ink, clarifying wine and beer, and in medicine; also, a substance that has a tanning effectTUMBLE: to whirl in a tumbling barrel, a revolving cask in which objects or materials undergo a process (such as drying or polishing) by being whirled aboutUNIT: an individual item of the products that a company makes or sells (12,000 units in inventory)WALK: a ropewalk, a long covered walk, building, or room where ropes are manufacturedWELD: a welded joint; also, union by welding: the state or condition of being welded; to become or be capable of being welded; to weld, to unite (metallic parts) by heating and allowing the metals to flow together or by hammering or compressing with or without previous heating; to unite (plastics) in a similar manner by heating; to repair (something) by welding; to produce or create as if by such a processWELDED: a welded joint; also, union by welding: the state or condition of being welded; to become or be capable of being welded; to weld, to unite (metallic parts) by heating and allowing the metals to flow together or by hammering or compressing with or without previous heating; to unite (plastics) in a similar manner by heating; to repair (something) by welding; to produce or create as if by such a processWELDING: a welded joint; also, union by welding: the state or condition of being welded; to become or be capable of being welded; to weld, to unite (metallic parts) by heating and allowing the metals to flow together or by hammering or compressing with or without previous heating; to unite (plastics) in a similar manner by heating; to repair (something) by welding; to produce or create as if by such a processWORK: the material or piece of material that is operated upon at any stage in the process of manufacture (The work was put under the drop hammer and quickly pounded into shape for the next operation.); also, to fashion or create a useful or desired product by expending labor or exertion on: to forge, to shape (work flint into tools); also, to permit of being worked: to react in a specified way to being worked (This wood works easily.); to prepare for use by stirring or kneading (worked the putty into the right consistency); to bring into a desired form by a gradual process of cutting, hammering, scraping, pressing, or stretching (work cold steel)WORKING: the material or piece of material that is operated upon at any stage in the process of manufacture (The work was put under the drop hammer and quickly pounded into shape for the next operation.); also, to fashion or create a useful or desired product by expending labor or exertion on: to forge, to shape (work flint into tools); also, to permit of being worked: to react in a specified way to being worked (This wood works easily.); to prepare for use by stirring or kneading (worked the putty into the right consistency); to bring into a desired form by a gradual process of cutting, hammering, scraping, pressing, or stretching (work cold steel)WROUGHT: worked into shape by artistry or effort (carefully wrought); processed for use: manufactured (wrought silk); beaten into shape by tools: hammered —used of metals; also, the material or piece of material that is operated upon at any stage in the process of manufacture (The work was put under the drop hammer and quickly pounded into shape for the next operation.); also, to fashion or create a useful or desired product by expending labor or exertion on: to forge, to shape (work flint into tools); also, to permit of being worked: to react in a specified way to being worked (This wood works easily.); to prepare for use by stirring or kneading (worked the putty into the right consistency); to bring into a desired form by a gradual process of cutting, hammering, scraping, pressing, or stretching (work cold steel)
Metallurgy
ALKALI: an alkali metal, any of the monovalent mostly basic metals of group I of the periodic table comprising lithium, sodium, potassium, rubidium, cesium, and franciumALLOY: to reduce the purity of by mixing with a less valuable metal; also, the degree of mixture with base metals: fineness; also, also, a substance composed of two or more metals or of a metal and a nonmetal intimately united usually by being fused together and dissolving in each other when molten; also: the state of union of the componentsALLOYED: to reduce the purity of by mixing with a less valuable metal; also, the degree of mixture with base metals: fineness; also, also, a substance composed of two or more metals or of a metal and a nonmetal intimately united usually by being fused together and dissolving in each other when molten; also: the state of union of the componentsALLOYING: to reduce the purity of by mixing with a less valuable metal; also, the degree of mixture with base metals: fineness; also, also, a substance composed of two or more metals or of a metal and a nonmetal intimately united usually by being fused together and dissolving in each other when molten; also: the state of union of the componentsALUM: aluminum, a silver-white metallic chemical element with atomic number 13 that has good electrical and thermal conductivity, high reflectivity, and resistance to oxidationALUMINA: the oxide of aluminum Al2O3 that occurs both in pure form as corundum and in hydrated forms (as in bauxite)ALUMINUM: a silver-white metallic chemical element with atomic number 13 that has good electrical and thermal conductivity, high reflectivity, and resistance to oxidation —often used before another noun ANTIMONY: a trivalent and pentavalent metalloid element with atomic number 51 that commonly occurs in a brittle, metallic, silvery white crystalline form and that is used especially in alloys, semiconductors, and flame-retardant substancesBLOOM: a mass of wrought iron from the forge or puddling furnace, or a bar of iron or steel hammered or rolled from an ingotBLOW: metallurgy: the time during which air is forced through molten metal to refine it; also, the quantity of metal refined during that timeBORON: a metalloid chemical elementCLAD: to sheathe, to face, specifically: to cover (a metal) with another metal by bonding (stainless steel plates were clad with copper); also, a composite material formed by cladding; also, cladding: something that covers or overlays, specifically: metal coating bonded to a metal coreCOBALT: a magnetic metallic element that is used especially in alloys, in batteries, and as a pigment in paint and glassCURIUM: a metallic radioactive chemical element that is only produced artificially; New Latin, from Marie & Pierre CurieDRAFT: the act, result, or plan of lengthening or stretching something (such as threads or metal)DUCTILE: of a metal: capable of being drawn out into wire or thread (ductile iron)DUCTILITY: the quality or state of being ductile, especially: the ability of a material to have its shape changed (as by being drawn out into wire or thread) without losing strength or breakingFINE: of a metal: having a stated proportion of pure metal in the composition expressed in parts per thousand (a gold coin .9166 fine)FOUND: to melt (a material, such as metal) and pour into a moldFOUNDED: to melt (a material, such as metal) and pour into a moldFOUNDING: to melt (a material, such as metal) and pour into a moldFOUNDRY: an establishment where founding is carried on; also, the act, process, or art of casting metalsGALLIUM: a bluish-white metallic element obtained especially as a by-product in refining various ores and used especially in semiconductors and optoelectronic devices; named by its discoverer “in honor of France (Gallia).”GOLD: a yellow metallic element that occurs naturally in pure form and is used especially in coins, jewelry, and electronicsGOLDEN: consisting of, relating to, or containing gold, a yellow metallic element that occurs naturally in pure form and is used especially in coins, jewelry, and electronicsGRAIN: an individual crystal in a metalINDIUM: a silvery malleable fusible chiefly trivalent metallic element that occurs especially in sphalerite ores and is used especially as a plating material, in alloys, and in electronicsINGOT: a mass of metal cast into a convenient shape for storage or transportation to be later processed; also, a mold in which metal is castIRON: a silver-white malleable ductile magnetic heavy metallic element …; of, relating to, or made of iron; resembling ironIRONWORK: work in iron; also: something made of ironIRONWORKING: the process of fashioning things from ironLAME: a thin plate especially of metal: lamina; also, lames plural: small overlapping steel plates joined to slide on one another (as in medieval armor)LEAD: (noun) a soft, heavy, metallic element with atomic number 82 found mostly in combination and used especially in alloys, batteries, and shields against sound, vibration, or radiation; also, also, to cover, line, or weight with lead; to treat or mix with lead or a lead compound (leaded gasoline)LEADED: (noun) a soft, heavy, metallic element with atomic number 82 found mostly in combination and used especially in alloys, batteries, and shields against sound, vibration, or radiation; also, also, to cover, line, or weight with lead; to treat or mix with lead or a lead compound (leaded gasoline)LEADEN: made of leadLEAF: metal (such as gold or silver) in sheets usually thinner than foilMANTLE: the outer wall and casing of a blast furnace above the hearth; broadly: an insulated support or casing in which something is heatedMATTE: a crude mixture of sulfides formed in smelting sulfide ores of metals (such as copper, lead, or nickel)METAL: any of various opaque, fusible, ductile, and typically lustrous substances that are good conductors of electricity and heat, form cations by loss of electrons, and yield basic oxides and hydroxides; especially: one that is a chemical element as distinguished from an alloy; also, to cover or furnish with metalMETALLIC: of, relating to, or being a metal; also, made of or containing a metal; also, having properties of a metal; also, yielding metal; also, resembling metalNICKEL: or less commonly nickle: a silver-white hard malleable ductile metallic element capable of a high polish and resistant to corrosion that is used chiefly in alloys and as a catalystPATINA: a usually green film formed naturally on copper and bronze by long exposure or artificially (as by acids) and often valued aesthetically for its colorPLATE: forged, rolled, or cast metal in sheets usually thicker than ¹/₄ inch (6 millimeters); also, a very thin layer of metal deposited on a surface of base metal by platingPUDDLE: to subject (iron) to the process of puddlingPUDDLED: to subject (iron) to the process of puddlingTAIN*: Not in M-W. Collins has a thin tin plate; or tin foil for the backs of mirrorsTANTALUM: a gray-white ductile acid-resisting metallic element found combined in rare minerals (such as tantalite and columbite) and used especially in electronic components; from Latin Tantalus; from its inability to absorb acid (Tantalus: a legendary king of Lydia condemned to stand up to the chin in a pool of water in Hades and beneath fruit-laden boughs only to have the water or fruit recede at each attempt to drink or eat)TINFOIL: a paper-thin metal sheeting usually of aluminum or tin-lead alloyTINNED: to cover or plate with tin or a tin alloyTINNING: to cover or plate with tin or a tin alloyTINNY: resembling tin; also, of, abounding in, or yielding tinTITANIUM: a silvery-gray light strong metallic element with atomic number 22 obtained from ilmenite and rutile and used especially in alloys, refractory materials, pigments, and medical and dental devices; New Latin, from Greek Titan: any of a family of giants in Greek mythology born of Uranus and Gaea and ruling the earth until overthrown by the Olympian godsURANIUM: a silvery heavy radioactive polyvalent metallic element that is found especially in uraninite and exists naturally as a mixture of mostly nonfissionable isotopes; from Uranus, the sky personified as a god and father of the Titans in Greek mythology VIRGIN: of a metal: produced directly from ore by primary smeltingWHITE: made of silverWINNING: to recover (metal) from oreYTTRIUM: yttrium, a metallic element with atomic number 39 usually included in the rare-earth group that occurs usually with other rare earth elements in minerals and is used especially in phosphors, YAG lasers, alloys, and treatments for certain cancers, from yttria yttrium oxide (Y2O3), irregular from Ytterby, town in southern SwedenZINC: a bluish-white metallic element with atomic number 30 that is ductile when pure but in the commercial form is brittle at ordinary temperatures and becomes ductile on slight heating, occurs abundantly in minerals, is an essential micronutrient for both plants and animals, and is used especially in alloys and as a protective coating in galvanizing iron and steel —often used before another noun (a zinc coating); also, to treat or coat with zinc: to galvanize
Mines and Mining
AIRWAY: a passage for a current of air (as in a mine or to the lungs)BONANZA: mining: an exceptionally large and rich mineral deposit (as of an ore, precious metal, or petroleum)COLOR: a small particle of gold in a gold miner's pan after washingCOLOUR*: chiefly British spelling of color; a small particle of gold in a gold miner's pan after washingDRIFT: a nearly horizontal mine passageway driven on or parallel to the course of a vein or rock stratum, or a small crosscut in a mine connecting two larger tunnelsDUFF: fine coal; slack, that is, the finest screenings of coal produced at a mine unusable as fuel unless cleanedFOOTWALL: the lower underlying wall of a vein, ore deposit, or coal seam in a mineJIGGING: to separate (a mineral or ore from waste) with a jigLEAD: a lode, an ore depositLEAN: of ore: containing little valuable mineralLEANLY: of ore: containing little valuable mineralLEDGE: a lode (ore deposit) or vein (a bed of useful mineral matter)LEVEL: a horizontal passage in a mine intended for regular working and transportationLIFT: a set of pumps used in a mineLODE: an ore depositMINE: a pit or excavation in the earth from which mineral substances are taken; also, an ore deposit; also, to get (something, such as ore) from the earth; to dig a mine; to dig into for ore or metalMINED: a pit or excavation in the earth from which mineral substances are taken; also, an ore deposit; also, to get (something, such as ore) from the earth; to dig a mine; to dig into for ore or metalMINING: a pit or excavation in the earth from which mineral substances are taken; also, an ore deposit; also, to get (something, such as ore) from the earth; to dig a mine; to dig into for ore or metalMUCK: material removed in the process of excavating or mining; also, to move or load muck (as in a mine)NATAL: native: found in nature especially in an unadulterated form (mining native silver)NATIVE: native: found in nature especially in an unadulterated form (mining native silver)NUGGET: a native lump of precious metalPANNED: to separate (a substance, such as gold) by panning; to wash material (such as earth or gravel) in a pan in search of metal (such as gold); to yield precious metal in the process of panning —usually used with outPANNING: to separate (a substance, such as gold) by panning; to wash material (such as earth or gravel) in a pan in search of metal (such as gold); to yield precious metal in the process of panning —usually used with outPILLAR: a solid mass of coal, rock, or ore left standing to support a mine roof; also, to provide or strengthen with or as if with pillarsPOCKET: a cavity containing a deposit (as of gold, water, or gas)PULP: pulverized ore mixed with waterTAIL: tailing: residue separated in the preparation of various products (such as grain or ores) —usually used in pluralTAILING: residue separated in the preparation of various products (such as grain or ores) —usually used in pluralTINNY: of, abounding in, or yielding tinTIPPLE: a place where or an apparatus by which cars (as for coal) are loaded or emptied; also, a coal-screening plantTRAP: an arrangement of rock strata that favors the accumulation of oil and gasTUNNEL: a subterranean gallery (as in a mine); also, to make or use a tunnel; also, to make a tunnel or similar opening through or under; also: to make (one's way) by or as if by making a tunnelVEIN: a lode, an ore deposit; also, bed of useful mineral matterWELL: a shaft or hole sunk to obtain oil, brine, or gas; also, a deep vertical hole; also, something resembling a well in being damp, cool, deep, or darkWILDCAT: of, relating to, or being an oil or gas well drilled in territory not known to be productive (wildcat drilling); also, a wildcat oil or gas well; also, to prospect and drill an experimental oil or gas well or sink a mine shaft in territory not known to be productiveWINNING: to obtain (something, such as ore, coal, or clay) by mining; also, to prepare (a vein or bed) for regular mining; also, to recover (metal) from oreWORK: works plural: structures in engineering (such as docks, bridges, or embankments) or mining (such as shafts or tunnels)WORKING: an excavation or group of excavations made in mining, quarrying, or tunneling —usually used in plural
Paper and Plastic Products
BOARD: cardboardBOLT: a roll of wallpaper of specified lengthBOND: bond paperBOOK: a packet of items bound together like a book (a book of stamps, a book of matches)BOOKS: a packet of items bound together like a book (a book of stamps, a book of matches)BOXING: material used for boxes and casingsCARDBOARD: a material made from cellulose fiber (such as wood pulp) like paper but usually thickerCARTON: a box or container usually made of cardboard and often of corrugated cardboard; also, (verb), to shape cartons from cardboard sheets or to pack or enclose in a carton CLING: a sheet of material (such as plastic or vinyl) designed to adhere to a flat surface by static electricity and often printed with an image or messageCLOTH: a pliable material made usually by weaving, felting, or knitting natural or synthetic fibers and filaments; a similar material (as of glass) (Woven glass cloth produces a strong laminate.)CONFETTI: small bits or streamers of brightly colored paper made for throwing (as at weddings)DECKLE: noun: a frame around the edges of a mold used in making paper by handENVELOPE: a flat usually paper container (as for a letter)FILM: a thin flexible transparent sheet (as of plastic) used especially as a wrappingFLAP: an extended part forming the closure (as of an envelope or carton)HEMP: the fiber of hemp (used to produce paper and construction materials), or a fiber (such as jute) from a plant other than the true hempKRAFT*: a strong paper or cardboard made from wood pulp produced from wood chips boiled in an alkaline solution containing sodium sulfateLINEN: paper made from linen fibers or with a linen finishMANILA: made of manila paper, a strong and durable paper of a brownish or buff color and smooth finish made originally from Manila hempNAPKIN: a sanitary napkin, a disposable absorbent pad used (as during menstruation) to absorb the uterine flowNOTE: a sheet of notepaperNYLON: any of numerous strong tough elastic synthetic polyamide materials that are fashioned into fibers, filaments, bristles, or sheets and used especially in textiles and plasticsPACK: material used in packing; also, to fill with packing (pack a joint in a pipe)PACKABLE: material used in packing; also, to fill with packing (pack a joint in a pipe)PACKED: material used in packing; also, to fill with packing (pack a joint in a pipe)PAPYRI: plural of papyrus, the pith of the papyrus plant especially when made into strips and pressed into a material to write onPORTFOLIO: a hinged cover or flexible case for carrying loose papers, pictures, or pamphletsPULP: a material prepared by chemical or mechanical means from various materials (such as wood or rags) for use in making paper and cellulose products; also, to reduce to pulp (pulped unsold copies of the book)PULPED: a material prepared by chemical or mechanical means from various materials (such as wood or rags) for use in making paper and cellulose products; also, to reduce to pulp (pulped unsold copies of the book)TAPE: adhesive tapeVELLUM: a strong cream-colored paperVINYL: a monovalent radical CH2=CH derived from ethylene by removal of one hydrogen atom; also, a polymer of a vinyl compound or a product (such as a resin or a textile fiber) made from such a polymer —often used before another noun (a house with vinyl siding, vinyl tiles/flooring)WALLET: a folder, a folded cover or large envelope for holding or filing loose papersWEBBED: [having or resembling a web,] a continuous sheet of paper manufactured or undergoing manufacture on a paper machine; also, a roll of paper for use in a rotary printing pressWINDOW: the transparent panel or opening of a window envelope, an envelope having an opening through which the address on the enclosure is visible
Spelling Bee words related to MANUFACTURING, PRODUCTS, AND PACKAGING
ACACIAACIDAIRTIGHTAIRWAYALKALIALLIGATORALLOYALLOYEDALLOYINGALPACAALUMALUMINAALUMINUMANGORAANNEALANNEALEDANNEALING ANTIMONYBAGGEDBAGGIEBAGGINGBAILBAKEBAKEDBAKINGBALKBARKBATHBATTENBEAMBEAMEDBEAMINGBELLYBILGEBILLETBINNEDBINNING BITUMENBLOOMBLOWBOARDBOATBOATYARDBOBBEDBOBBINGBOBSBOLTBOMBBONANZABONDBOOKBOOKSBORONBOTTLEBOUGHBOXINGBRANCHBRANDBUCKBUFFBUFFEDBUFFSBUNGBURLBURRBUTTBUTTEDBUTTINGCADDYCALFCAMELCANTCAPPEDCAPPINGCARDBOARDCARTONCATCHCATCHALLCHIMECHINCHILLACHIPCHIPPEDCHIPPINGCLADCLAVECLEAVECLEFTCLINGCLIPCLOTHCOBALTCOLDCOLORCOLOUR*CONFETTICONTENTCOOKCOOKEDCOOKINGCOOLANTCOON*CORDCORDOVANCORKCORKINGCRIMPCRIMPINGCROCCROCKCUPPINGCURIUMCURLCURLYDAPPEDDAPPINGDEADWOODDEALDECKLEDIPPEDDIPPINGDOCKYARDDOPEDRAFTDRIFTDUCTILEDUCTILITYDUFFEMPTYENVELOPEFACTORYFEEDFEEDINGFELLFETTLEFILMFINEFLANGEFLANGINGFLAPFLEECEFLOORBOARDFOOTWALLFORGINGFORMFORTYFOUNDFOUNDEDFOUNDINGFOUNDRYFUNNELGALLIUMGNARLGNARLYGOLDGOLDENGRAINGROGHACKLEHEMPHIDEHOOPHOOPEDHOOPINGHORNINDIUMINGOTIRON IRONWOODIRONWORKIRONWORKINGJIGGINGKILNKILNING*KNAR*KNEEKNOTKNOTHOLEKRAFT*
LAMBLAMELANDLAPPEDLAPPINGLATHLATHEDLATHINGLEADLEADENLEAFLEANLEANLYLEDGELEVELLIDDEDLIFTLIMB LINDENLINELINENLIZARDLOADLOADEDLOADINGLODELOGGEDLOGGINGLOGROLLLONGNECKLOPPINGMACHININGMAGNUMMANILAMANTLEMATTEMETALMETALLICMILLMINEMINEDMININGMINKMINTMINTEDMINTINGMOCHAMORDANTMOROCCOMORTARMOUTHMUCKNAPKINNATALNATIVENECKNICKELNOTENUGGETNYLONOAKENOOZEOPENPACKPACKABLEPACKEDPADDEDPADDINGPAILPANNEDPANNINGPAPYRIPATENTPATINAPEANUTPELTPELTEDPHIALPILLARPINEPINEWOODPINTPLANKPLANKINGPLANTPLATEPLUGPOCKETPOLEPOLLARD*PORTPORTFOLIOPOTTEDPOTTINGPUDDLEPUDDLEDPULPPULPEDPUMAPUNKPUNTQUARTRABBITRACCOONRAFFIARAWLYRICKRINDRINGRIPPINGRIPPLYROANROLLRUNNINGTAILTAILINGTAIN*TALLBOYTALLOWTANKTANNEDTANNICTANNINTANNINGTANTALUMTAPETEAKTINFOILTINNEDTINNINGTINNYTIPPEDTIPPINGTIPPLETITANIUMTOONTRAPTRAYTROUGHTUBETUMBLETUNNELTUPELOUNITURANIUMVEINVELLUM VENEERVIALVINYLVIRGINWALKWALLETWANEWEBBEDWELDWELDEDWELDINGWELLWHITEWILDCATWILLOWWINDOWWINNINGWOLFWOODWOODENWOODWORKWOOLWOOLENWOOLLYWORKWORKINGWORMYWRAPWRAPPINGWROUGHTYARDYOLKYOLKYYTTRIUMZINC
LexiConnexxions New York Times Spelling Bee answers analysis statistics peregrine
If you cite information from LexiConnexxions, please give credit and a link to the relevant page. These reports and analyses are conceived, compiled, designed, and prepared by a human being, not a machine. This website is 100% AI-free; it is conceived, designed, written, and maintained by a human being. Except where noted, all content ©2022-2026 and in perpetuity by LexiConnexxions. All rights reserved. Dissemination, re-use, or duplication by any means, for any purpose whatsoever, is prohibited except by express written permission of LexiConnexxions. This site is not affiliated with The New York Times or with any other sites related to the New York Times Spelling Bee. Contact LexiConnexxions at info // @ // lexiconnexxions.com.

We use cookies only to enable essential functionality on this website. We do not save, analyze, share, rent, or sell this information. By clicking Accept, you consent to our use of cookies. Cookies and Privacy Policy.

Your Cookie Settings

We use cookies to enable essential functionality on our website and analyze website traffic. For more information, read our Cookies and Privacy Policy below..

Cookie Categories
Essential

These cookies are strictly necessary to provide you with services available through our websites.

Analytics

These cookies collect information that is used in aggregate and in an anonymized form to help us understand how our website is being used and how effectively our site is performing.