LexiTopic: Motions: Coming and Going
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to MOTIONS: COMING AND GOING in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to MOTIONS: COMING AND GOING
SUBJECT HEADINGS IN THIS LEXITOPIC:
Approaching, Advancing, ArrivingCollisions and Entanglements not string, etc.Dawdling and Dillydallying wasting timeEmerging, Exiting Evading, EscapingLeading and Following literal, not figurativeProceeding general, neither fast or slow; includes odd ways of proceeding (bellying, battling, etc.), roaming, etc.Proceeding Quickly, AcceleratingProceeding Slowly, DeceleratingReversing, Retracing, ReturningStarting and Departing not escapeStoppingTurning, Changing Direction
NOTES ABOUT THE TAXONOMY FOR MOTIONS: COMING AND GOING
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to movement to and from any place, starting and stopping, changing direction, proceeding in various ways.
Words related to human ambulation (Walking, Running, Leaping) are in PEOPLE: MOVEMENTS AND MOTIONS.
Words related to specific modes of transportation, etc., are in TRANSPORTATION AND TRAVEL, AVIATION AND AIRCRAFT, and NAUTICAL AND MARITIME.
Words related to place, position, and location are in PLACES AND SPACES.
Words related to time and the passage of time, as well as words related to delaying, pausing, and waiting, are in TIME.
Words related to measures of velocity are in MEASURES AND MEASUREMENTS.
Words related to roads, highways, trails, paths, and walkways are in TRANSPORTATION AND TRAVEL.
Words related to animal behaviors and movements are in ANIMALS.
Words related to abstract concepts of leadership (of other people) are in PEOPLE: ENGAGEMENT AND INTERACTION.
Topical arrangement of Spelling Bee words related to MOTIONS: COMING AND GOING
Approaching, Advancing, Arriving
ADVANCE: to bring or move forwardADVANCED: to bring or move forwardAPPROACH: to draw closer to: to near; to draw nearer; also, an act or instance of approaching (e.g., the approach of summer)ARRIVAL: the act of arriving, or one that has recently arrivedARRIVING: to reach a destination (The train arrived late.); to make an appearance: to come upon the scene (the crowd applauded when the singer arrived on stage)CAME: to move toward something: to approach; to move or journey to a vicinity with a specified purpose; to advance in a particular manner (come running); to appear on a scene: to make an appearance; to arrive at a particular placeCOME: to move toward something: to approach; to move or journey to a vicinity with a specified purpose; to advance in a particular manner (come running); to appear on a scene: to make an appearance; to arrive at a particular placeCOMING: to move toward something: to approach; to move or journey to a vicinity with a specified purpose; to advance in a particular manner (come running); to appear on a scene: to make an appearance; to arrive at a particular placeGAIN: to get closer to something pursued —usually used with on or upon; to arrive at: reach, attain; to traverse or cover (to gain a distance)GAINED: to get closer to something pursued —usually used with on or upon; to arrive at: reach, attain; to traverse or cover (to gain a distance)GAINING: to get closer to something pursued —usually used with on or upon; to arrive at: reach, attain; to traverse or cover (to gain a distance)GRAVITATING: to move toward somethingHITTING: to arrive or appear at, in, or on (hit town by 5pm, best time to hit the stores); to arrive with a forceful effect like that of a blow (the storm hit)INCOMING: arriving; also, the act of arrivalLAND: to come to the end of a course or to a stage in a journey: to arrive (took a wrong turn and landed on a dead-end street); to cause to reach or come to rest in a particular place (never landed a punch)LANDED: to come to the end of a course or to a stage in a journey: to arrive (took a wrong turn and landed on a dead-end street); to cause to reach or come to rest in a particular place (never landed a punch)LANDING: to come to the end of a course or to a stage in a journey: to arrive (took a wrong turn and landed on a dead-end street); to cause to reach or come to rest in a particular place (never landed a punch)LODGE: to come to a rest (the bullet lodged in the wall); to bring to an intended or a fixed position (as by throwing or thrusting)LODGED: to come to a rest (the bullet lodged in the wall); to bring to an intended or a fixed position (as by throwing or thrusting)LODGING: to come to a rest (the bullet lodged in the wall); to bring to an intended or a fixed position (as by throwing or thrusting)MADE: to reach, to attain (made port before the storm); —often used with it (you'll never make it that far)MAKE: to reach, to attain (made port before the storm); —often used with it (you'll never make it that far)MAKING: to reach, to attain (made port before the storm); —often used with it (you'll never make it that far)NOODGING*: variant of nudge, to approachNUDGE: to approachNUDGED: to approachNUDGING: to approachPOUR: to move or come continuously: to stream (complaints poured in)POURING: to move or come continuously: to stream (complaints poured in)RAMP: to stand or advance menacingly with forelegs or with arms raised; ROLL: to flow in a continuous stream: to pour (clouds were rolling in)TUMBLE: an act or instance of tumbling; also, to come by chance: to stumble upon
Collisions and Entanglements not string, etc.
CAROM: a rebounding especially at an angle; also, to strike and rebound: to glance (the car caromed off a tree); also, to proceed by or as if by caroms (carom from city to city); by shortening & alteration from obsolete carambole, from Spanish carambolaCHAMP: to trampleCOLLIDE: to come together with solid or direct impact; to clash (colliding cultures)COLLIDED: to come together with solid or direct impact; to clash (colliding cultures)COLLIDING: to come together with solid or direct impact; to clash (colliding cultures)FOUL: an entanglement or collision especially in angling or sailing; also, to tangle or come into collision with, or to become entangled or come into collisionFOULED: an entanglement or collision especially in angling or sailing; also, to tangle or come into collision with, or to become entangled or come into collisionFOULS: an entanglement or collision especially in angling or sailing; also, to tangle or come into collision with, or to become entangled or come into collisionHITTING: to come in quick forceful contact with; to cause to come into contact (She accidentally hit her head getting into the car.); to come into contact with something (the plate shattered when it hit the floor)KNOCK: to collide with somethingKNOCKED: to collide with somethingKNOCKING: to collide with somethingRUNNING: to cause to collide (ran his head into a post)THICKET: something resembling a thicket in density or impenetrability: a tangle (a political thicket, a thicket of reporters)WEDGE: to force (one's way) into or throughWEDGED: to force (one's way) into or throughWEDGING: to force (one's way) into or through
Dawdling and Dillydallying wasting time
BUMMED: to loaf (bummed around the house all day)BUMMING: to loaf (bummed around the house all day)CHILL: to hang, informal: to pass time idly or in relaxing or socializing: hang around, hang outCHILLED: to hang, informal: to pass time idly or in relaxing or socializing: hang around, hang outCHILLING: to hang, informal: to pass time idly or in relaxing or socializing: hang around, hang outDALLIED: to waste time, to linger, to dawdle, to deal lightly, to toyDALLY: to waste time, to linger, to dawdle, to deal lightly, to toyDALLYING: to waste time, to linger, to dawdle, to deal lightly, to toyDAWDLE: to spend time idly; to move lackadaisically; to spend [time] fruitlessly or lackadaisicallyDAWDLED: to spend time idly; to move lackadaisically; to spend [time] fruitlessly or lackadaisicallyDIDDLE: to waste (time) in trifling; to dawdle, to foolDIDDLED: to waste (time) in trifling; to dawdle, to foolDIDDLING: to waste (time) in trifling; to dawdle, to foolDILLYDALLIED: to waste time by loitering or delaying; reduplication of dallyDILLYDALLY: to waste time by loitering or delaying; reduplication of dallyDILLYDALLYING: to waste time by loitering or delaying; reduplication of dallyDOZE: to pass (time) drowsilyDOZED: to pass (time) drowsilyDOZING: to pass (time) drowsilyDRONING: to pass, proceed, or act in a dull, drowsy, or indifferent manner; to pass or spend in dull or monotonous activity or in idlenessEMPTY: idle (empty hours)
FIDDLE: to spend time in aimless or fruitless activity: to putter, tinker (fiddled around with the engine for hours)FIDDLED: to spend time in aimless or fruitless activity: to putter, tinker (fiddled around with the engine for hours)FIDDLING: to spend time in aimless or fruitless activity: to putter, tinker (fiddled around with the engine for hours)GOOF: to spend time idly or foolishly, or to engage in playful activity,GOOFED: to spend time idly or foolishly, or to engage in playful activity,GOOFING: to spend time idly or foolishly, or to engage in playful activity,HACK: to loaf —usually used with around (I hacked around in those parts for a long time)HACKED: to loaf —usually used with around (I hacked around in those parts for a long time)HANG: informal: to pass time idly or in relaxing or socializing: hang around, hang out (hanging with friends, hanging at the beach)HANGING: informal: to pass time idly or in relaxing or socializing: hang around, hang out (hanging with friends, hanging at the beach)HUNG: informal: to pass time idly or in relaxing or socializing: hang around, hang out (hanging with friends, hanging at the beach)IDLE: to move idlyIDLED: to move idlyIDLING: to move idlyIDLY: in an idle mannerKILL: to get through a period of time uneventfully (to kill time)KILLED: to get through a period of time uneventfully (to kill time)KILLING: to get through a period of time uneventfully (to kill time)LALLYGAG: less common spelling of lollygag, to fool around and waste time: to dawdleLALLYGAGGED: less common spelling of lollygag, to fool around and waste time: to dawdleLALLYGAGGING: less common spelling of lollygag, to fool around and waste time: to dawdleLAZE: to act or lie lazily: to idle; to pass (time) in idleness or relaxationLAZED: to act or lie lazily: to idle; to pass (time) in idleness or relaxationLAZILY: disinclined to activity or exertion: not energetic or vigorous; encouraging inactivity or indolence (a lazy summer day); moving slowly: sluggish (a lazy river); to move or lie lazily: to lazeLAZING: to act or lie lazily: to idle; to pass (time) in idleness or relaxationLAZY: disinclined to activity or exertion: not energetic or vigorous; encouraging inactivity or indolence (a lazy summer day); moving slowly: sluggish (a lazy river); to move or lie lazily: to lazeLOAF: to spend time in idlenessLOAFS: to spend time in idlenessLOLL: to act or move in a lax, lazy, or indolent manner: to loungeLOLLED: to act or move in a lax, lazy, or indolent manner: to loungeLOLLING: to act or move in a lax, lazy, or indolent manner: to loungeLOLLYGAG: or less commonly lallygag, to fool around and waste time: to dawdleLOLLYGAGGED: or less commonly lallygag, to fool around and waste time: to dawdleLOLLYGAGGING: or less commonly lallygag, to fool around and waste time: to dawdleLOUNGING: to act or move idly or lazily; to loaf; to pass (time) idly LOUNGY: suitable for lounging; idleMOON: to spend in idle reverie: to dream (mooned away the afternoon); to spend time in idle reverie: to behave abstractedly (mooned over the movie stars)MOONED: to spend in idle reverie: to dream (mooned away the afternoon); to spend time in idle reverie: to behave abstractedly (mooned over the movie stars)MOONING: to spend in idle reverie: to dream (mooned away the afternoon); to spend time in idle reverie: to behave abstractedly (mooned over the movie stars)MOPE: to move slowly or aimlessly: to dawdleMOPED: to move slowly or aimlessly: to dawdleMOPEY: to move slowly or aimlessly: to dawdleMUCK: to engage in aimless activity —usually used with about or around; to putter, tinker —usually used with about or around (mucking around with his computer)NIGGLE: to trifle; to spend too much effort on minor detailsNIGGLING: to trifle; to spend too much effort on minor detailsPEDDLE: to be busy with trifles: to piddlePEDDLED: to be busy with trifles: to piddlePIDDLE: to dawdle, to putterPIDDLED: to dawdle, to putterPIDDLING: to dawdle, to putterPOKE: to move or act slowly or aimlessly (just poked around and didn't accomplish much)PUTZ: US, informal: to spend time in an aimless or idle manner: to putter, fool around —usually + aroundPUTZED: US, informal: to spend time in an aimless or idle manner: to putter, fool around —usually + aroundTRUANCY: an act or instance of playing truant : the state of being truantTRUANT: (verb) to idle away time especially while playing truantVACANCY: physical or mental inactivity or relaxation: idleness; the state of being vacant; vacuity, the state, fact, or quality of being vacuous; devoid of serious occupation: idleVACANT: free from activity or work (vacant hours)WHILE: to cause to pass especially without boredom or in a pleasant manner —usually used with away (while away the time)WHILING: to cause to pass especially without boredom or in a pleasant manner —usually used with away (while away the time)WILE: [by alteration]: while, to cause to pass especially without boredom or in a pleasant manner —usually used with away (while away the time)
Evading, Escaping
BOLT: to break away from control or a set course; to dart off or away: to fleeDODGE: an act of evading by sudden bodily movement; also, to make a sudden movement in a new direction (as to evade a blow or to avoid an encounter)DODGED: an act of evading by sudden bodily movement; also, to make a sudden movement in a new direction (as to evade a blow or to avoid an encounter)DODGING: an act of evading by sudden bodily movement; also, to make a sudden movement in a new direction (as to evade a blow or to avoid an encounter)DUCK: to move quickly, especially away (to duck out of a room)DUCKED: to move quickly, especially away (to duck out of a room)ELUDE: to avoid adroitly: to evadeELUDED: to avoid adroitly: to evadeEVADE: to slip away; to elude by dexterity or stratagemEVADED: to slip away; to elude by dexterity or stratagemEVADING: to slip away; to elude by dexterity or stratagemFLED: to run away often from danger or evil: to fly; to hurry toward a place of security; to run away fromFLEE: to run away often from danger or evil: to fly; to hurry toward a place of security; to run away fromFLEEING: to run away often from danger or evil: to fly; to hurry toward a place of security; to run away fromFLEW: to take flight: to flee (flew from enemies); to flee or escape from (the bird flew from its cage)FLOWN: to take flight: to flee (flew from enemies); to flee or escape from (the bird flew from its cage)FLYING: to take flight: to flee (flew from enemies); to flee or escape from (the bird flew from its cage)LAMMED*: to flee hastily: to scramPARRY: to evade or turn aside something (can parry and thrust … without losing the thread of his argument)ROUT: to put to precipitate flight; to drive out: dispelRUNNING: to flee, retreat, escape; also, to slip or go through or past (run a blockade, run a red light)RUNOUT: Not in M-W; Collins has an act or instance of running away so as to evade, abandon, or avoid something
SQUEAK: an escape (a close squeak) SQUEAKS: an escape (a close squeak)TIPTOE: cautious, stealthy; also, to … proceed quietly or cautiously on or as if on tiptoe;TIPTOED: cautious, stealthy; also, to … proceed quietly or cautiously on or as if on tiptoe;WEAVE: to direct (something, such as the body) in a winding or zigzag course especially to avoid obstacles; to move in a devious, winding, or zigzag course especially to avoid obstaclesWEAVING: to direct (something, such as the body) in a winding or zigzag course especially to avoid obstacles; to move in a devious, winding, or zigzag course especially to avoid obstacles
Leading and Following literal, not figurative
BRING: to lead or cause to come along with one toward the place from which the action is being regarded (brought the hikers through the canyon)BRINGING: to lead or cause to come along with one toward the place from which the action is being regarded (brought the hikers through the canyon)BROUGHT: to lead or cause to come along with one toward the place from which the action is being regarded (brought the hikers through the canyon)CONDUCT: to bring by or as if by leading: guide (conduct tourists through a museum); of a road or passage: to show the way: leadCONDUCTED: to bring by or as if by leading: guide (conduct tourists through a museum); of a road or passage: to show the way: leadFOLLOW: to go, proceed, or come afterFOLLOWED: to go, proceed, or come afterFOLLOWING: to go, proceed, or come afterGUIDE: one that leads or directs another's way; a person who exhibits and explains points of interest; also, to act as a guide to: direct in a way or course; something that provides a person with guiding information (signs, stars, etc.)GUIDED: to act as a guide to: direct in a way or courseGUIDING: to act as a guide to: direct in a way or courseHAND: to lead, guide, or assist with the hand (hand a lady into a bus)HANDED: to lead, guide, or assist with the hand (hand a lady into a bus)HANDING: to lead, guide, or assist with the hand (hand a lady into a bus)LEAD: to guide on a way especially by going in advance; to guide someone or something along a way (You lead and we'll follow.); to direct on a course or in a direction (a road leading the traveler to the heart of the city)LIGHT: to conduct with a light: to guide (to light the way)LIGHTED: to conduct with a light: to guide (to light the way)LIGHTING: to conduct with a light: to guide (to light the way)PACE: to go before: precede; to set an example for: to leadPACED: to go before: precede; to set an example for: to leadPACING: to go before: precede; to set an example for: to leadPILOT: to act as a guide: to lead or conduct over a usually difficult coursePILOTING: to act as a guide: to lead or conduct over a usually difficult courseTAGGED: to follow closely and persistently; to keep close (tagging at their heels)TAGGING: to follow closely and persistently; to keep close (tagging at their heels)TAIL: to follow or be drawn behind like a tailTAILING: to follow or be drawn behind like a tailTRACK: detectable evidence (such as the wake of a ship, a line of footprints, or a wheel rut) that something has passed; also, to follow the tracks or traces of: to trail; to search for by following evidence until found (track down the source); to follow by vestiges: to traceTRAIL: a course followed or to be followed (hit the campaign trail); also, something that follows or moves along as if being drawn along: a train (a trail of admirers); also, to follow in the footsteps of: to pursue; to follow along behind; to lag behind (someone, such as a competitor)URGING: to force or impel in an indicated direction or into motion or greater speed (A hand on my back urged me forward.) (The dog urged the sheep toward the gate.)
Proceeding general, neither fast or slow; includes odd ways of proceeding (bellying, battling, etc.), roaming, etc.
AWAY: on the way: along (get away early); steadily onward: uninterruptedly (clocks ticking away)BATTLE: to force, thrust, or drive by battling (battling his way through the crowd)BELLIED: to slide or crawl on one's bellyBELLY: to slide or crawl on one's bellyBOUND: intending to go: going (bound for home, college-bound)BUFFET: to make one's way especially under difficult conditionsBUMP: to proceed in an up and down motion across a rough surface (The truck bumped along the dirt road.)BUMPING: to proceed in an up and down motion across a rough surface (The truck bumped along the dirt road.)CHUG: to move or go with or as if with chugs, a dull explosive sound made by or as if by a laboring engineCHUGGING: to move or go with or as if with chugs, a dull explosive sound made by or as if by a laboring engineCLOMP: to walk or move clumsily and noisilyFALL: to come or go as if by falling (darkness falls early in the winter)FALLEN: to come or go as if by falling (darkness falls early in the winter)FALLING: to come or go as if by falling (darkness falls early in the winter)FALLS: to come or go as if by falling (darkness falls early in the winter)FELL: to come or go as if by falling (darkness falls early in the winter)FLOAT: to wander; to move about without a fixed course, aim, or goal; to go idly about: to rambleFUNNEL: to pass through or as if through a funnel or conduit (the crowd funnels through the doors); to move to a focal point or into a conduit or central channel (contributions were funneled into one account, Campaign funds were secretly funneled to a former staffer.)FUNNELED: to pass through or as if through a funnel or conduit (the crowd funnels through the doors); to move to a focal point or into a conduit or central channel (contributions were funneled into one account, Campaign funds were secretly funneled to a former staffer.)FUNNELING: to pass through or as if through a funnel or conduit (the crowd funnels through the doors); to move to a focal point or into a conduit or central channel (contributions were funneled into one account, Campaign funds were secretly funneled to a former staffer.)GOING: an act or instance of going; also, present participle of to go, to move or travel in a particular way or direction or for a particular distance (went by train, go straight at the intersection); —often used figuratively (He'll go far in life.); to move or travel to a place especially for a particular purpose (goes to the office every morning); to travel to and stay in a place for a period of time (went to Paris for a month); to do something that involves or implies moving or traveling to a place (They went running when they heard the noise.); to proceed along or according to: to follow (going the usual way) —often used figuratively (He has always gone his own way.)GOING: present participle of to go, to proceed without delay and often in a thoughtless or reckless manner —used especially to intensify a complementary verb (Why did you go and spoil it?) (go jump in a lake)GONE: past participle of to go, to move or travel in a particular way or direction or for a particular distance (went by train, go straight at the intersection); —often used figuratively (He'll go far in life.); to move or travel to a place especially for a particular purpose (goes to the office every morning); to travel to and stay in a place for a period of time (went to Paris for a month); to do something that involves or implies moving or traveling to a place (They went running when they heard the noise.); to proceed along or according to: to follow (going the usual way) —often used figuratively (He has always gone his own way.)GONE: past participle of to go, to proceed without delay and often in a thoughtless or reckless manner —used especially to intensify a complementary verb (Why did you go and spoil it?) (go jump in a lake)GONNA: pronunciation spelling, —used for "going to" in informal speech and in representations of such speech (It's not gonna be easy.)HAPPEN: to come or go casually: make a chance appearanceHAPPENED: to come or go casually: make a chance appearanceHAPPENING: to come or go casually: make a chance appearanceHARRY: to force to move along by harassingHAUL: to move along: to proceedHAULED: to move along: to proceedHAULING: to move along: to proceedHOME: to move to or toward an objective by following a signal or landmarkHOMED: to move to or toward an objective by following a signal or landmarkHOMING: to move to or toward an objective by following a signal or landmarkHUFF: to proceed with labored breathing (e.g., huffed up to the peak)HUFFED: to proceed with labored breathing (e.g., huffed up to the peak)KNIFING: to move like a knife in (birds knifing the autumn sky); to cut a way with or as if with a knife blade (the cruiser knifed through the heavy seas)LEVEL: proceeding monotonously or uneventfullyLEVELLY: proceeding monotonously or uneventfullyLOGGED: to move (an indicated distance) or attain (an indicated speed) as noted in a logLOGGING: to move (an indicated distance) or attain (an indicated speed) as noted in a logMADE: to set out, to head (made after the fox; made straight for home); MAKE: to set out, to head (made after the fox; made straight for home); MAKING: to set out, to head (made after the fox; made straight for home); MARCH: to move in a direct purposeful manner: to proceed; to make steady progress: to advance; also, forward movement: progressMOVE: to go or pass to another place or in a certain direction with a continuous motion; to cause to advance (moved the troops closer to the enemy); to proceed toward a certain state or condition (moving up the executive ladder); to keep pace (moving with the times)
MOVED: to go or pass to another place or in a certain direction with a continuous motion; to cause to advance (moved the troops closer to the enemy); to proceed toward a certain state or condition (moving up the executive ladder); to keep pace (moving with the times)NAVIGATING: to make one's way over or through: to traverse NAVIGATION: the act or practice of navigating, to get around, to move (was well enough to navigate under his own power)PACE: to move along: to proceedPACED: to move along: to proceedPACING: to move along: to proceedPEGGED: to move along vigorously or hastily: to: hustlePEGGING: to move along vigorously or hastily: to: hustlePIKE: to make one's way (pike along)PILE: to move or press forward in or as if in a mass: to crowd (piled into the car)PILED: to move or press forward in or as if in a mass: to crowd (piled into the car)PILING: to move or press forward in or as if in a mass: to crowd (piled into the car)PLIED: to go or travel regularly over, on, or through (jets plying the skies); to go or travel regularlyPLYING: to go or travel regularly over, on, or through (the jet plies the sky); to go or travel regularlyPOUND: to move with a heavy repetitive sound; to move along heavily or persistently (pounded the pavement looking for work)POUNDED: to move with a heavy repetitive sound; to move along heavily or persistently (pounded the pavement looking for work)PROWL: to move about or wander stealthily in or as if in search of prey; to roam over in a predatory manner; also, an act or instance of prowlingRANDOM: a haphazard courseRANGING: to rove over or through; to roam at large or freely; to move over an area so as to explore it; to sail or pass along; to have rangeRANGY: having room for ranging; having great scope; able to range for considerable distancesROAM: to go from place to place without purpose or direction: to wander (roamed about, enjoying the scenery); to travel purposefully unhindered through a wide area (cattle roaming in search of water); to range or wander over (spent the day roaming the hills)ROCK: to move forward at a steady paceROCKING: to move forward at a steady paceROLL: to impel forward by causing to turn over and over on a surface; to impel forward with an easy continuous motion; to move on rollers or wheels (rolled the patient into the operating room); to move along a surface by rotation without slidingROLL: to move about: to roam, wander; to go forward in an easy, gentle, or undulating manner (The waves rolled in.)ROUNDING: to go around [an area]; to pass from place to place: to go here and thereROUNDING: to pass part of the way around (slipped while rounding first base)
ROVE: an act or instance of wandering; also, to move aimlessly: to roam; to wander through or overROVER: a wanderer, a roamerRUNNING: to roam, rove (running about with no jacket); to move on or as if on wheels: glide; to roll forward rapidly or freely; to pass or slide freely; to go back and forth: ply (the train runs between New York and Washington) (The buses are running late.)TAKE: to go along, into, or through (took a different route); to pass or attempt to pass through, along, or over (took the curve too fast, take the stairs two at a time); to put oneself into (sun, air, water, etc.) for pleasure or physical benefit (take the air)TAKEN: to go along, into, or through (took a different route); to pass or attempt to pass through, along, or over (took the curve too fast, take the stairs two at a time); to put oneself into (sun, air, water, etc.) for pleasure or physical benefit (take the air)THROUGH: used as a function word to indicate movement into something at one side or point and out at another and especially the opposite side of; by way of (she came in through the side door); used as a function word to indicate passage from one end or boundary to another (a highway through the forest) —used as a function word to indicate movement within a place or area of land, air, etc. (flew through the air); without stopping for: past (drove through a red light)TOOK: to go along, into, or through (took a different route); to pass or attempt to pass through, along, or over (took the curve too fast, take the stairs two at a time); to put oneself into (sun, air, water, etc.) for pleasure or physical benefit (take the air)WALK: of an inanimate object: to move in a manner that is suggestive of walking; to stand with an appearance suggestive of strides (pylons walking across the valley); to cause to move by walking (walked her bicycle up the hill); to move (an object) in a manner suggestive of walkingWANT: to desire to come, go, or be (the cat wants in) (he wants out of the deal); to wish or demand the presence of (I want you here at ten o’clock.)WEND: to direct one's course: to travel; also, to proceed on (one's way): to directWENDED: to direct one's course: to travel; also, to proceed on (one's way): to directWENDING: to direct one's course: to travel; also, to proceed on (one's way): to directWENT: past tense of to go, to move or travel in a particular way or direction or for a particular distance (went by train, go straight at the intersection); —often used figuratively (He'll go far in life.); to move or travel to a place especially for a particular purpose (goes to the office every morning); to travel to and stay in a place for a period of time (went to Paris for a month); to do something that involves or implies moving or traveling to a place (They went running when they heard the noise.); to proceed along or according to: to follow (going the usual way) —often used figuratively (He has always gone his own way.)WENT: past tense of to go, to proceed without delay and often in a thoughtless or reckless manner —used especially to intensify a complementary verb (Why did you go and spoil it?) (go jump in a lake)
Proceeding Quickly, Accelerating
BELT: to move or act in a speedy, vigorous, or violent manner (he belted across the room)BELTING: to move or act in a speedy, vigorous, or violent manner (he belted across the room)BLAZE: to proceed extremely rapidly BLAZING: to proceed extremely rapidly BLEW: to move or run quickly (she blew by me)BLOW: to move or run quickly (she blew by me)BLOWING: to move or run quickly (she blew by me)BLOWN: to move or run quickly (she blew by me)BOLT: to move or proceed rapidly: to dashBOMB: informal: to move rapidly (a car bombing down the hill)BOMBED: informal: to move rapidly (a car bombing down the hill)BOMBING: informal: to move rapidly (a car bombing down the hill)BOWL: to travel smoothly and rapidly (as in a wheeled vehicle) (to bowl along)BOWLED: to travel smoothly and rapidly (as in a wheeled vehicle) (to bowl along)BOWLING: to travel smoothly and rapidly (as in a wheeled vehicle) (to bowl along)BUNDLING: to hustle or hurry unceremoniously (bundled the children off to school); hurry, hustle (servants came bundling from the kitchen)CLIP: a rate, a quantity, amount, or degree of something measured per unit of something else [especially speed] (continues at a brisk clip); also, to travel or pass rapidly (clip along)CLIPPED: a rate, a quantity, amount, or degree of something measured per unit of something else [especially speed] (continues at a brisk clip); also, to travel or pass rapidly (clip along)CRACK: to go or travel at good speed usually used with on (the steamboat cracked on)FLEW: to move, pass, or spread quicklyFLIT: to pass quickly or abruptly from one place or condition to anotherFLITTING: to pass quickly or abruptly from one place or condition to anotherFLOWN: to move, pass, or spread quicklyFLUNG: to move in a brusque or headlong manner
FLYING: to move, pass, or spread quickly
FORCING: to raise or accelerate to the utmost (forcing the pace); to hasten the rate of progress or growth ofHANG: to stay even: to keep up —usually used with with (trying to hang with the leader)HANGING: to stay even: to keep up —usually used with with (trying to hang with the leader)HIED*: to go quickly, to hastenHIEING*: to go quickly, to hastenHIGHTAIL: to move at full speed or rapidly often in making a retreatHIGHTAILING: to move at full speed or rapidly often in making a retreatHUNG: to stay even: to keep up —usually used with with (trying to hang with the leader)HURL: to rush, to hurtleHURRY: to carry or cause to go with hasteLANCE: to move forward quicklyLANCED: to move forward quicklyLANCING: to move forward quicklyLIGHTNING: having or moving with or as if with the speed and suddenness of lightningMOTOR: to move or proceed at a vigorous steady pace (motored down the field for a touchdown)NIPPED: to move briskly, nimbly, or quicklyNIPPING: to move briskly, nimbly, or quicklyOUTRAN: to run faster thanOUTRUN: to run faster thanPELT: to move rapidly and vigorously: to hurryPELTED: to move rapidly and vigorously: to hurryRACING: to go, move, or function at top speed or out of control (people racing for safety, struggled to sleep as his mind raced)RAMMING: to move with extreme rapidityRAMP: to speed up, expand, decrease, or increase especially quickly or at a constant rate —used with up or downRAVING: to move or advance violently: to stormRIPPING: to go or move very quickly (fire ripped through the forest)ROAR: to proceed or rush with great noise or commotion (The truck roared away/off.), —sometimes used figuratively (The team came roaring back in the last quarter to win the game.)ROARING: to proceed or rush with great noise or commotion (The truck roared away/off.), —sometimes used figuratively (The team came roaring back in the last quarter to win the game.)ROCK: to move forward at a high speed (the train rocked through the countryside)ROCKING: to move forward at a high speed (the train rocked through the countryside)RUNNING: to go rapidly or hurriedly: hasten (run and fetch the doctor); to spread or pass quickly from point to point (chills ran up her spine); to pass over or traverse with speedTORN: past participle of tear, to move or act with violence, haste, or force (went tearing down the street)TROT: to proceed briskly: to hurryWALLOP: to move with reckless or disorganized haste: to advance in a headlong rushWHIP: to proceed nimbly or quickly (whipped through the long agenda)WHIPPING: to proceed nimbly or quickly (whipped through the long agenda)WHIR: or less commonly whirr, a continuous fluttering or vibratory sound made by something in rapid motion (the whir of machinery); also, to fly, revolve, or move rapidly with a whir (hummingbirds whirring past); to move or carry rapidly with a whirWHIRL: to pass, move, or go quickly (whirled down the hallway)WHIRR: or more commonly whir, a continuous fluttering or vibratory sound made by something in rapid motion (the whir of machinery); also, to fly, revolve, or move rapidly with a whir (hummingbirds whirring past); to move or carry rapidly with a whirWHIZ: or whizz, a hissing, buzzing, or whirring sound; also, a movement or passage of something accompanied by a whizzing soundWHIZZ: or whiz, a hissing, buzzing, or whirring sound; also, a movement or passage of something accompanied by a whizzing soundWHIZZING: whiz or whizz, a hissing, buzzing, or whirring sound; also, a movement or passage of something accompanied by a whizzing soundWING: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGED: swift, rapid; also, a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGING: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyZING: to zip, to speedZINGING: to zip, to speedZIPPED: to move, act, or function with speed and vigor; to impart speed or force to; to transport or propel with speedZOOM: to go speedily: to zip (cars zooming by on the highway)ZOOMED: to go speedily: to zip (cars zooming by on the highway)
Proceeding Slowly, Decelerating
CHECK: to slow or bring to a stop: to brakeCHECKED: to slow or bring to a stop: to brakeCHECKING: to slow or bring to a stop: to brakeDRAG: motion effected with slowness or difficulty; also, to cause to move with slowness or difficulty; to proceed or continue laboriously or tediously (The lawsuit dragged on for years.); to hang or lag behind (Stop dragging and hurry up.)DRAGGING: motion effected with slowness or difficulty; also, to cause to move with slowness or difficulty; to proceed or continue laboriously or tediously (The lawsuit dragged on for years.); to hang or lag behind (Stop dragging and hurry up.)
EASE: to move or pass slowly or easily —often used with a directional word (such as over or up) (the limo eased up in front of the house)EASES: to move or pass slowly or easily —often used with a directional word (such as over or up) (the limo eased up in front of the house)EASY: not hurried or strenuous (an easy pace); without undue speed or excitement (take it easy)HANG: a hesitation or slackening in motion or in a course (a marked hang of the oar in the air before it dipped)INCH: to progress slowly; to cause to move slowlyINCHED: to progress slowly; to cause to move slowlyINCHING: to progress slowly; to cause to move slowlyLAGGARD: lagging or tending to lag: slow especially compared to others of the same kind; also, someone or something that lags or lingers: someone or something that is slow especially compared to others of the same kindLAGGARDLY: lagging or tending to lag: slow especially compared to others of the same kindLAGGED: to stay or fall behind: to fail to keep up with others or with a goal, schedule, etc.; to move, function, or develop with comparative slownessLAGGING: to stay or fall behind: to fail to keep up with others or with a goal, schedule, etc.; to move, function, or develop with comparative slownessLIMP: to proceed slowly or with difficulty (the ship limped back to port)LIMPING: to proceed slowly or with difficulty (the ship limped back to port)LOBBED: to move slowly and heavilyLOBBING: to move slowly and heavilyLOBS: to move slowly and heavilyMIRING: to cause to stick fast in or as if in mire; to stick or sink in mireMOOCH: to move slowly or apathetically: to wander aimlesslyMOOCHING: to move slowly or apathetically: to wander aimlesslyOOZE: to move slowly or imperceptibly (the crowd began to ooze forward)OOZED: to move slowly or imperceptibly (the crowd began to ooze forward)OOZING: to move slowly or imperceptibly (the crowd began to ooze forward)PICK: to make (one's way) slowly and carefully (picked his way through the rubble)PICKED: to make (one's way) slowly and carefully (picked his way through the rubble)PLOD: to proceed slowly or tediously (the movie's plot just plods along)PLODDING: to proceed slowly or tediously (the movie's plot just plods along)POKE: to make (one's way) by poking (poked his way through the ruins)RAMP: to speed up, expand, decrease, or increase especially quickly or at a constant rate —used with up or downTAIL: to form or move in a straggling lineTAILING: to form or move in a straggling lineTARDY: moving slowly: sluggish (a tardy pace)TOOTLE: to drive or move along in a leisurely mannerTOOTLED: to drive or move along in a leisurely mannerWADE: an act of wading; also, to move or proceed with difficulty or labor (wade through the crowd)WADED: an act of wading; also, to move or proceed with difficulty or labor (wade through the crowd)WADING: an act of wading; also, to move or proceed with difficulty or labor (wade through the crowd)WORK: to make way slowly and with difficulty: move or progress laboriously (worked her way through the crowd); to get (oneself or an object) into or out of a condition or position by gradual stages (patiently working the boulder out of the hole)WORKING: to make way slowly and with difficulty: move or progress laboriously (worked her way through the crowd); to get (oneself or an object) into or out of a condition or position by gradual stages (patiently working the boulder out of the hole)
Reversing, Retracing, Returning
BACK: to move backward (e.g., backed into a parking space); BACKTRACK: to retrace one's course; to go back to an earlier point in a sequence; to reverse a positionHOME: to go or return to one's place of residence or origin: to go or return homeHOMED: to go or return to one's place of residence or origin: to go or return homeHOMING: to go or return to one's place of residence or origin: to go or return homeRUNNING: to follow the trail of [something] backward: to trace (ran the rumor to its source)TINED: Not in M-W, Collins, or NOAD; but M-W has tine, dialectal British: to lose; to become lostTURN: the action or an act of turning so as to face in the opposite direction: reversal of posture or course; also, to reverse a course or direction (the tide has turned, (figurative) our luck turned); to cause to retreat (a blocked road turned the crowd); to cause to rebound or recoil (turns their argument against them)TURNAROUND: a turnabout: a change or reversal of direction, trend, policy, role, or character (a corporate turnaround)
Starting and Departing not escape
BEGONE: to go away: depart —used especially in the imperativeBETAKE: to cause (oneself) to goBETAKEN: to cause (oneself) to goBETOOK: to cause (oneself) to goBOOK: slang: to leave, to go; especially: to depart quickly (we booked out of there)BOOKED: slang: to leave, to go; especially: to depart quickly (we booked out of there)BOOKS: slang: to leave, to go; especially: to depart quickly (we booked out of there)DIPPED: US slang: to leave especially suddenly or prematurely (I didn't know anyone at the party so I dipped.) —often used with outDIPPING: US slang: to leave especially suddenly or prematurely (I didn't know anyone at the party so I dipped.) —often used with outGOING: present participle of to go, to move out of or away from a place expressed or implied: to leave, depart (went from school to the party) ( We need to go.); present participle of to go, to pass by means of a process like journeying (The message went by email.)GONE: past participle of to go, to move out of or away from a place expressed or implied: to leave, depart (went from school to the party) ( We need to go.); past participle of to go, to pass by means of a process like journeying (The message went by email.)KEEP: to restrain from departure or removalKEEPING: to restrain from departure or removalKEPT: past tense and past participle of keep: to restrain from departure or removalLEAVE: an act of leaving: departure; also, to go away from: to depart (leave the room); to set out, depart (left for the office at eight sharp); to desert, abandon (left his wife); to terminate association with: withdraw from (left school before graduation)LEFT: an act of leaving: departure; also, to go away from: to depart (leave the room); to set out, depart (left for the office at eight sharp); to desert, abandon (left his wife); to terminate association with: withdraw from (left school before graduation)MOVE: to start away from some point or place: to depart (It was getting late and it was time to be moving.)
MOVED: to start away from some point or place: to depart (It was getting late and it was time to be moving.)OUTGO: the act of going out; departureOUTGOING: going away: departing (an outgoing ship)PACK: to cause or command to go without ceremony (packed him off to school); to go away without ceremony: depart (simply packed up and left)PACKED: to cause or command to go without ceremony (packed him off to school); to go away without ceremony: depart (simply packed up and left)PART: to separate from or take leave of someone; to take leave of one another; to go away: to depart; to remove from contact or associationPIKE: to leave abruptlyQUIT: to depart from or out of (she quit that town); to leave the company ofQUITTING: to depart from or out of (she quit that town); to leave the company ofTAKE: to betake oneself: to set out: to go (take after a purse snatcher)TAKEN: to betake oneself: to set out: to go (take after a purse snatcher)TAKEOFF: an action of starting out; also, a starting point: a point of departure; also, a spot at which one takes offTOOK: to betake oneself: to set out: to go (take after a purse snatcher)TUMBLE: an act or instance of tumbling; also, to issue forth hurriedly and confusedly (tumble out of bed)WENT: past tense of to go, to move out of or away from a place expressed or implied: to leave, depart (went from school to the party) ( We need to go.); past tense of to go, to pass by means of a process like journeying (The message went by email.)
Stopping
CHECK: a sudden stoppage of a forward course or progress: arrest; one that arrests, limits, or restrains: restraint; also, to slow or bring to a stop: to brakeCHECKED: a sudden stoppage of a forward course or progress: arrest; one that arrests, limits, or restrains: restraint; also, to slow or bring to a stop: to brakeCHECKING: a sudden stoppage of a forward course or progress: arrest; one that arrests, limits, or restrains: restraint; also, to slow or bring to a stop: to brakeDEAD: abrupt (brought to a dead stop)HALT: to cease marching or journeyingHALTED: to cease marching or journeyingHALTING: to cease marching or journeying
Turning, Changing Direction
ANGLE: to turn or proceed at an angle; to turn, move, or direct at an angle; also, the direction from which someone or something is approached; also, a sharply divergent courseANGLED: to turn or proceed at an angle; to turn, move, or direct at an angle; also, the direction from which someone or something is approached; also, a sharply divergent courseANGLING: to turn or proceed at an angle; to turn, move, or direct at an angle; also, the direction from which someone or something is approached; also, a sharply divergent courseBEND: a curved part of a path (as of a stream or road) (Their house is down the road, just past the bend.); also, to cause to turn from a straight course: to deflect (bend a ray of light with a mirror); to guide or turn toward: to direct (bends his steps toward home)BENDING: a curved part of a path (as of a stream or road) (Their house is down the road, just past the bend.); also, to cause to turn from a straight course: to deflect (bend a ray of light with a mirror); to guide or turn toward: to direct (bends his steps toward home)CHOP: to change direction; to veer with or as if with windCHOPPING: to change direction; to veer with or as if with windCRAB: to move sideways indirectly or diagonally; to scuttle or scurry sideways; to cause to move sideways or in an indirect or diagonal manner; to subject to crabbingDEVIATE: to cause to turn out of a previous course (a flight forced by weather to deviate south)DEVIATED: to cause to turn out of a previous course (a flight forced by weather to deviate south)DODGE: to move to and fro or from place to place usually in an irregular courseDODGED: to move to and fro or from place to place usually in an irregular courseDODGING: to move to and fro or from place to place usually in an irregular courseDOGLEG: to proceed along a dogleg course, or having doglegsDOGLEGGED: to proceed along a dogleg course, or having doglegsELBOW: to make an angle: to turnELBOWED: to make an angle: to turnINFLECT: to turn from a direct line or course: curveRIGHT: a turn to the right (take a right at the stop sign)ROUNDING: a circling or circuitous path or course; also, to follow a winding course: to bend; to encircle, encompassTACK: a zigzag movement on land; also, to follow a zigzag course (tacked through the crowd)TACKED: a zigzag movement on land; also, to follow a zigzag course (tacked through the crowd)TACKING: a zigzag movement on land; also, to follow a zigzag course (tacked through the crowd)TRAIL: to move, flow, or extend slowly in thin streams (smoke trailing from chimneys); to extend in an erratic or uneven course or line: to straggleTURN: the action or an act of giving or taking a different direction: a change of course or posture (an illegal left turn, a turn toward the light)TURNAROUND: a turnabout: a change or reversal of direction, trend, policy, role, or character (a corporate turnaround)TURNOFF: a turning offTWINE: to stretch or move in a sinuous manner: to meander (the river twines through the valley; the queue twined around the building)TWINING: to stretch or move in a sinuous manner: to meander (the river twines through the valley; the queue twined around the building)
VEER: a change in course or direction (a veer to the right); also, to change direction or course (the economy veered sharply downward)WARP: to deflect from a courseWARPING: to deflect from a courseWEAVE: to direct (something, such as the body) in a winding or zigzag course especially to avoid obstacles; to move in a devious, winding, or zigzag course especially to avoid obstaclesWEAVING: to direct (something, such as the body) in a winding or zigzag course especially to avoid obstacles; to move in a devious, winding, or zigzag course especially to avoid obstaclesWHEEL: to change direction as if revolving on a pivot (… the battalion wheeled to the flank) (wheeled to face her opponent); to cause to change direction as if revolving on a pivotWHEELING: to change direction as if revolving on a pivot (… the battalion wheeled to the flank) (wheeled to face her opponent); to cause to change direction as if revolving on a pivotWHIRL: to turn abruptly around or aside: to: wheel (whirled around in surprise); to cause to turn abruptly around or asideWIGGLE: to proceed with or as if with twisting and turning movements: to wriggleWIGGLED: to proceed with or as if with twisting and turning movements: to wriggleWIGGLING: to proceed with or as if with twisting and turning movements: to wriggleWIGGLY: tending to wiggle: wiggling, wrigglyWIND: to traverse on a curving course (the river winds the valley); to cause to move in a curving line or path; to effect by or as if by curving; to cause (something, such as a ship) to change direction: to turn; to proceed as if by windingWINDING: to traverse on a curving course (the river winds the valley); to cause to move in a curving line or path; to effect by or as if by curving; to cause (something, such as a ship) to change direction: to turn; to proceed as if by windingWORM: to move or proceed sinuously or insidiously; to proceed or make (one's way) insidiously or deviously; to cause to move or proceed in or as if in the manner of a wormWOUND: a curved or sinuous course, line, or progress; having a course that winds (a winding road); also, to traverse on a curving course (the river winds the valley); to cause to move in a curving line or path; to effect by or as if by curving; to cause (something, such as a ship) to change direction: to turn; to proceed as if by windingWRONG: (adv) in a wrong direction (turned wrong at the junction)ZAGGED: to execute a zag, one of the sharp turns, angles, or alterations in a zigzag course, or one of the short straight lines or sections of a zigzag course at an angle to a zig, or a zig, a sharp alteration or change of direction (as in a process or policy) —usually contrasted with zig; shortened from zigzagZAGGING: to execute a zag, one of the sharp turns, angles, or alterations in a zigzag course, or one of the short straight lines or sections of a zigzag course at an angle to a zig, or a zig, a sharp alteration or change of direction (as in a process or policy) —usually contrasted with zig; shortened from zigzagZIGGED: to execute a zig, one of the sharp turns, angles, or alterations in a zigzag course, or one of the short straight lines or sections of a zigzag course at an angle to a zag, or a sharp alteration or change of direction (as in a process or policy);—usually contrasted with zag; shortened from zigzagZIGGING: to execute a zig, one of the sharp turns, angles, or alterations in a zigzag course, or one of the short straight lines or sections of a zigzag course at an angle to a zag, or a sharp alteration or change of direction (as in a process or policy);—usually contrasted with zag; shortened from zigzagZIGZAG: one of a series of short sharp turns, angles, or alterations in a course; also, something having the form or character of such a series; also (adv) in or by a zigzag path or course; also, (adj) having short sharp turns or angles; also, to form into a zigzag or move along a zigzag course; to lie in, proceed along, or consist of a zigzag courseZIGZAGGED: one of a series of short sharp turns, angles, or alterations in a course; also, something having the form or character of such a series; also (adv) in or by a zigzag path or course; also, (adj) having short sharp turns or angles; also, to form into a zigzag or move along a zigzag course; to lie in, proceed along, or consist of a zigzag courseZIGZAGGING: one of a series of short sharp turns, angles, or alterations in a course; also, something having the form or character of such a series; also (adv) in or by a zigzag path or course; also, (adj) having short sharp turns or angles; also, to form into a zigzag or move along a zigzag course; to lie in, proceed along, or consist of a zigzag courseZIGZAGGY: one of a series of short sharp turns, angles, or alterations in a course; also, something having the form or character of such a series; also (adv) in or by a zigzag path or course; also, (adj) having short sharp turns or angles
Spelling Bee words related to
MOTIONS: COMING AND GOING
ADVANCEADVANCEDANGLEANGLEDANGLINGAPPROACHARRIVALARRIVINGAWAYBACKBACKTRACKBATTLEBEGONEBELLIEDBELLYBELTBELTINGBENDBENDINGBETAKEBETAKENBETOOKBLAZEBLAZINGBLEWBLOWBLOWINGBLOWNBOLTBOLTBOMBBOMBEDBOMBINGBOOKBOOKEDBOOKSBOUNDBOWLBOWLEDBOWLINGBRINGBRINGINGBROUGHTBUFFETBUMMEDBUMMINGBUMPBUMPINGBUNDLINGCAMECAROMCHAMPCHECKCHECKEDCHECKINGCHILLCHILLEDCHILLINGCHOPCHOPPINGCHUGCHUGGINGCLIPCLIPPEDCLOMPCOLLIDECOLLIDEDCOLLIDINGCOMECOMINGCONDUCTCONDUCTEDCRABCRACKDALLIEDDALLYDALLYINGDAWDLEDAWDLEDDEADDEVIATEDEVIATEDDIDDLEDIDDLEDDIDDLINGDILLYDALLIEDDILLYDALLYDILLYDALLYINGDIPPEDDIPPINGDODGEDODGEDDODGINGDOGLEGDOGLEGGEDDOZEDOZEDDOZINGDRAGDRAGGINGDRONINGDUCKDUCKED
EASEEASESEASYELBOWELBOWEDELUDEELUDEDEMPTYEVADEEVADEDEVADINGFALLFALLENFALLINGFALLSFELL
FIDDLEFIDDLEDFIDDLINGFLEDFLEEFLEEINGFLEWFLITFLITTINGFLOATFLOWNFLUNGFLYINGFOLLOWFOLLOWEDFOLLOWING
FORCINGFOULFOULEDFOULSFUNNELFUNNELEDFUNNELINGGAINGAINEDGAININGGOINGGONEGONNAGOOFGOOFEDGOOFINGGRAVITATINGGUIDEGUIDEDGUIDINGHACKHACKEDHALTHALTEDHALTINGHANDHANDEDHANDINGHANGHANGINGHAPPENHAPPENEDHAPPENINGHARRYHAULHAULEDHAULINGHIED*HIEING*HIGHTAILHIGHTAILINGHITTINGHOMEHOMEDHOMINGHUFFHUFFEDHUNGHUNGHURLHURRYIDLEIDLEDIDLINGIDLYINCHINCHEDINCHINGINCOMINGINFLECTKEEPKEEPINGKEPTKILLKILLEDKILLINGKNIFINGKNOCKKNOCKEDKNOCKINGLAGGARDLAGGARDLYLAGGEDLAGGINGLALLYGAGLALLYGAGGEDLALLYGAGGINGLAMMED*LANCELANCEDLANCINGLANDLANDEDLANDING
LAZELAZEDLAZILYLAZINGLAZY
LEADLEAVELEFTLEVELLEVELLYLIGHTLIGHTEDLIGHTINGLIGHTNINGLIMPLIMPINGLOAFLOAFSLOBBEDLOBBINGLOBSLODGELODGEDLODGINGLOGGEDLOGGINGLOLLLOLLEDLOLLINGLOLLYGAGLOLLYGAGGEDLOLLYGAGGINGLOUNGINGLOUNGYMADEMAKEMAKINGMARCHMIRINGMOOCHMOOCHINGMOONMOONEDMOONINGMOPEMOPEDMOPEYMOTORMOVE
MOVEDMUCKNAVIGATINGNAVIGATIONNIGGLENIGGLINGNIPPEDNIPPINGNOODGING*NUDGENUDGEDNUDGINGOOZEOOZEDOOZINGOUTGOOUTGOINGOUTRANOUTRUNPACEPACEDPACINGPACKPACKEDPARRYPARTPEDDLEPEDDLEDPEGGEDPEGGINGPELTPELTEDPICKPICKEDPIDDLEPIDDLEDPIDDLINGPIKEPILEPILEDPILINGPILOTPILOTINGPLIEDPLODPLODDINGPLYINGPOKEPOUNDPOUNDEDPOURPOURINGPROWLPUTZPUTZEDQUITQUITTINGRACINGRAMMINGRAMPRANDOMRANGINGRANGYRAVINGRIGHTRIPPINGROAMROARROARINGROCKROCKINGROLLROUNDINGROUT
ROVE
ROVERRUNNINGRUNOUT
SQUEAKSQUEAKSTACKTACKEDTACKINGTAGGEDTAGGINGTAILTAILINGTAKETAKENTAKEOFFTARDYTHICKETTHROUGHTINEDTIPTOETIPTOEDTOOKTOOTLETOOTLEDTORNTRACKTRAILTROTTRUANCYTRUANTTUMBLETURNTURNAROUNDTURNOFFTWINETWININGURGINGVACANCYVACANT
VEERWADEWADEDWADINGWALKWALLOPWANTWARPWARPINGWEAVEWEAVINGWEDGEWEDGEDWEDGINGWENDWENDEDWENDINGWENTWHEELWHEELINGWHILEWHILINGWHIPWHIPPINGWHIRWHIRLWHIRRWHIZWHIZZWHIZZINGWIGGLEWIGGLEDWIGGLINGWIGGLYWILEWINDWINDINGWINGWINGEDWINGINGWORKWORKINGWORMWOUNDWRONGZAGGEDZAGGINGZIGGEDZIGGINGZIGZAGZIGZAGGEDZIGZAGGINGZIGZAGGYZINGZINGINGZIPPEDZOOMZOOMED