LexiTopic: Botanicals
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to BOTANICALS in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to BOTANICALS
SUBJECT HEADINGS IN THIS LEXITOPIC:
Cultivation, Habitat, etc.Ferns, Mosses, Lichens, Algae, etc.Flowers and Words about FlowersFungi, Molds, etc.GrassesLegumesOther PlantsPlant DiseasePlant Morphology including words about woodTrees and ShrubsWords about Botanicals
NOTES ABOUT THE TAXONOMY FOR BOTANICALS
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to plants, fungi, lichens, and all botanicals, as well as words related to cultivation, gardens, and gardening.
Words related to farming and large-scale agriculture are in AGRICULTURE AND FARM LIFE.
Words specific to habitat and environment are in ENVIRONMENT, HABITAT, AND NATURE.
Words related to specific plant products used as human food or drink, including the post-farm processing thereof, are in FOOD AND DRINK.
Words related to the brewing and processing of plants materials to produce drugs or alcoholic beverages are in INTOXICANTS.
Words related to lumber and lumbering products are in MANUFACTURING, PRODUCTS, AND PACKAGING.
Topical arrangement of Spelling Bee words related to BOTANICALS
Cultivation, Habitat, etc.
ALPINE: [not capitalized] a plant native to alpine or boreal regions that is often grown for ornamentANNUAL: a plant that completes its life cycle in one growing seasonARBOR: a shelter of vines or branches or of latticework covered with climbing shrubs or vinesBEDDING: suitable for planting in large groups in flower beds to produce a mass display
BIENNIAL: continuing or lasting for two years; specifically, of a plant: growing vegetatively during the first year and fruiting and dying during the second (Biennial herbs flower in their second year.)CLIMB: of a plant: to ascend in growth (as by twining); to grow up or overDEADHEAD: a faded blossom on a flowering plant; also, to remove a faded blossom on a flowering plantDEADHEADED: to remove a faded blossom on a flowering plantDRIFT: a grouping of similar flowers planted in an elongated massFLAT: a shallow container for shipping produce; also, a shallow box in which seedlings are startedFLAVOR: variety: any of various groups of plants or animals ranking below a species: subspecies
FORCING: to bring (plants) to maturity out of the normal season (forcing lilies for Easter)FRUITFUL: yielding or producing fruit (fruitful soil); conducive to an abundant yield (fruitful rain)FRUITION: the state of bearing fruitGRAFT: a grafted plant, or a living portion of a plant joined to a stock in grafting; or to propagate by graftingGRAFTING: a grafted plant, or a living portion of a plant joined to a stock in grafting; or to propagate by graftingHALOING: [not in M-W] the [disproven] practice of removing young trees from around older trees, with the goal of improving conditions for the older trees.HALOING: [not in M-W] the [disproven] practice of removing young trees from around older trees, with the goal of improving conditions for the older trees.HARD: of plants: hardy, resistant to stress or diseaseHARDY: of plants: hardy, resistant to stress or diseaseHEDGE: to plant, form, or trim a hedge; of, relating to, or designed for a hedge (a hedge plant); also, a fence or boundary formed by a dense row of shrubs or low trees; to enclose or protect with or as if with a dense row of shrubs or low trees; to enclose or protect with or as if with a hedge; to encircle (homes hedged with boxwoods)HEDGED: to plant, form, or trim a hedge; of, relating to, or designed for a hedge (a hedge plant); also, a fence or boundary formed by a dense row of shrubs or low trees; to enclose or protect with or as if with a dense row of shrubs or low trees; to enclose or protect with or as if with a hedge; to encircle (homes hedged with boxwoods)HEDGING: to plant, form, or trim a hedge; of, relating to, or designed for a hedge (a hedge plant); also, a fence or boundary formed by a dense row of shrubs or low trees; to enclose or protect with or as if with a dense row of shrubs or low trees; to enclose or protect with or as if with a hedge; to encircle (homes hedged with boxwoods)HEEL: the base of a tuber or cutting of a plant used for propagation of the plantHILL: several seeds or plants planted in a group rather than a row; also, to draw earth around the roots or base ofHILLED: to draw earth around the roots or base of [a plant or group of plants]HILLING: to draw earth around the roots or base of [a plant or group of plants]HOED: to work with a tool with a thin flat blade on a long handle to cultivate, weed, or loosen the earth around plants; to use or work with a hoe or backhoe; to weed, cultivate, or thin (a crop) with a hoe; to remove (weeds) by hoeing; to dress or cultivate (land) by hoeingHOEING: to work with a tool with a thin flat blade on a long handle to cultivate, weed, or loosen the earth around plants; to use or work with a hoe or backhoe; to weed, cultivate, or thin (a crop) with a hoe; to remove (weeds) by hoeing; to dress or cultivate (land) by hoeingIVIED: overgrown with ivyLOPPING: to cut off branches or twigs from; to sever from a woody plantMULE: a self-sterile plant whether hybrid or notMULTIPLY: to become greater in number; to spread; to breed, to propagateNETTLY*: having a profusion of nettlesNICOTINE: a poisonous alkaloid C10H14N2 that is the chief active principle of tobacco and is used as an insecticideNONDORMANT*: being in such a condition that germination is possible (nondormant seeds); also, being in active vegetative growth (nondormant plants)OAKY: of, relating to, or having many oaks (an oaky forest)PEAT: a dark brown fibrous material that is formed primarily by the partial decomposition of organic matter and especially plants (such as sphagnum moss) in wet, oxygen-deficient areas (such as bogs or swamps) and that is harvested especially for use as a fuel for heating or cooking or as a soil amendment; also, peat moss: sphagnum moss that has become compacted with other plant debris to form peat; also, dried and processed peat used especially as a soil amendmentPEATY: of or related to peatPINCH: to prune the tip of (a plant or shoot) usually to induce branchingPINCHING: to prune the tip of (a plant or shoot) usually to induce branchingPLANT: a young tree, vine, shrub, or herb planted or suitable for planting; also, an act of planting; also to put or set in the ground for growth; to set or sow with seeds or plants; to implant; to place in or on the groundPLANTABLE: suitable for, or capable of being be planted [lexi definitions]PLOT: a small area of planted ground (a vegetable plot); also, to lay out in plotsPLOTTING: a small area of planted ground (a vegetable plot); also, to lay out in plotsPOLL: to cut off or back the top of (something, such as a tree); specifically: to pollardPOLLARD*: a tree cut back to the trunk to promote the growth of a dense head of foliage; also, to make a pollard of (a tree)POLLING: to cut off or back the top of (something, such as a tree); specifically: to pollardPRICK: to remove (a young seedling) from the seedbed to another suitable for further growth —usually used with outPROPAGATOR: something that propagates: to cause to spread out and affect a greater number or greater area: to extendPRUNING: to cut off or cut back parts of for better shape or more fruitful growth (prune the branches)PUDDLE: a thin mixture of soil and water for puddling plants; also, to dip the roots of (a plant) in a thin mud before transplantingPUDDLED: a thin mixture of soil and water for puddling plants; also, to dip the roots of (a plant) in a thin mud before transplantingPULL: to pluck from a plant or by the roots (pull flowers, pull turnips)PULLED: to pluck from a plant or by the roots (pull flowers, pull turnips)QUADRAT: a usually rectangular plot used for ecological or population studiesRADICAL: a root part; also, of, relating to, or proceeding from a root: such as of or growing from the root of a plant (radical tubers), or growing from the base of a stem, from a rootlike stem, or from a stem that does not rise above the ground (radical leaves)RAMP: to creep up —used especially of plantsRANK: luxuriantly or excessively vigorous in growth (rank weeds)RANKLY: luxuriantly or excessively vigorous in growth (rank weeds)RING: to girdle: to cut away the bark and cambium in a ring around (a plant) usually to kill by interrupting the circulation of water and nutrientsRINGING: to girdle: to cut away the bark and cambium in a ring around (a plant) usually to kill by interrupting the circulation of water and nutrientsTAKE: a successful union (as of a graft); also, to establish a take especially by uniting or growing (90 percent of the grafts take)TAKEN: a successful union (as of a graft); also, to establish a take especially by uniting or growing (90 percent of the grafts take)TAME: to subject to cultivation; to become tame; reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated; also, to reduce from a wild to a domestic stateTAMED: to subject to cultivation; to become tame; reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated; also, to reduce from a wild to a domestic stateTAMELY: to subject to cultivation; to become tame; reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated; also, to reduce from a wild to a domestic stateTAMING: to subject to cultivation; to become tame; reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated; also, to reduce from a wild to a domestic stateTEND: to cultivate, to fosterTENDED: to cultivate, to fosterTHATCH: a mat of undecomposed plant material (such as grass clippings) accumulated next to the soil in a grassy area (such as a lawn)TOOK: a successful union (as of a graft); also, to establish a take especially by uniting or growing (90 percent of the grafts take)TOPIARY: of, relating to, or being the practice or art of training, cutting, and trimming trees or shrubs into odd or ornamental shapes; also: characterized by such work; also, a plant shaped by topiary art; topiary plants; topiary art or gardening; also: a topiary gardenTOPPED: to remove or cut the top of, especially: to shorten or remove the top of (a plant): to pinch, to prune the tip of (a plant or shoot) usually to induce branchingTOPPING: to remove or cut the top of, especially: to shorten or remove the top of (a plant): to pinch, to prune the tip of (a plant or shoot) usually to induce branching; also, something removed by toppingTRAIN: to direct the growth of (a plant) usually by bending, pruning, and tyingTURF: the upper stratum of soil bound by grass and plant roots into a thick mat; also, a piece of this; also, peat: a dark brown fibrous material that is formed primarily by the partial decomposition of organic matter and especially plants (such as sphagnum moss) in wet, oxygen-deficient areas (such as bogs or swamps) and that is harvested especially for use as a fuel for heating or cooking or as a soil amendment; also, a piece of peat dried for fuel; also, grass: land (such as a lawn or a turf racetrack) covered with growing grass; also, to cover with turfUNFRUITFUL: not fruitfulUNWEEDED: not weeded or culledUPROOT: to pull up by the roots (Many trees were uprooted by the storm.)VEGETABLE: a usually herbaceous plant (such as the cabbage, bean, or potato) grown for an edible part that is usually eaten as part of a meal; also: such an edible partVEGETAL: (adj) vegetative: promoting plant growth (the vegetative properties of soil); VIGOR: active healthy well-balanced growth especially of plantsWANTON: (adj) luxuriantly rank (wanton vegetation)WEED: a plant that is not valued where it is growing and is usually of vigorous growth, especially: one that tends to overgrow or choke out more desirable plants; also, a weedy growth of plants; also, to clear of weeds (weed a garden); also, to remove weeds or something harmfulWEEDED: a plant that is not valued where it is growing and is usually of vigorous growth, especially: one that tends to overgrow or choke out more desirable plants; also, a weedy growth of plants; also, to clear of weeds (weed a garden); also, to remove weeds or something harmfulWEEDING: a plant that is not valued where it is growing and is usually of vigorous growth, especially: one that tends to overgrow or choke out more desirable plants; also, a weedy growth of plants; also, to clear of weeds (weed a garden); also, to remove weeds or something harmfulWEEDY: abounding with or consisting of weeds; resembling a weed especially in vigorous growth or ready propagationWILDLING: wilding [preferred]: a plant growing uncultivated in the wild either as a native or an escape, especially: a wild apple or crab apple; also, the fruit of a wildingYARDWORK: M-W has open compound yard work, the work of maintaining or cultivating the yard or lawn of a home; Collins has closed compound yardwork, in American English, the work of caring for the lawn, plants, trees, etc. of a yard adjacent to a house
Ferns, Mosses, Lichens, Algae, etc.
AGAR: a gelatinous colloidal extract of a red alga (as of the genera Gelidium, Gracilaria, and Eucheuma) used especially in culture media or as a gelling and stabilizing agent in foods, or a culture medium containing agarALGA: any of a diverse group of chiefly photosynthetic and aquatic plantlike organisms that range from unicellular to large multicellular formsALGAE: any of a diverse group of chiefly photosynthetic and aquatic plantlike organisms that range from unicellular to large multicellular formsALGAL: related to alga and algaeBLOOM: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)BLOOMED: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)BLOOMING: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)DIATOM: any of a class (Bacillariophyceae) of minute planktonic unicellular or colonial algae with silicified skeletons that form diatomaceous earthHEPATIC: liverwort: any of a class (Hepaticae) of bryophytic plants characterized by a thalloid gametophyte or sometimes an upright leafy gametophyte that resembles a mossKELP: any of various large marine brown algae that are large seaweeds (order Laminariales) growing in cool waters; also, a mass or growth of large seaweedsLAMINA: the flattened photosynthetic part of an alga that typically arises from the stipeLAMINAE: the flattened photosynthetic part of an alga that typically arises from the stipeLAMINAL: arranged in, consisting of, or resembling laminae; a lamina is the flattened photosynthetic part of an alga that typically arises from the stipeLICHEN: any of numerous complex plantlike organisms made up of an alga or a cyanobacterium and a fungus growing in symbiotic association on a solid surface (such as on a rock or the bark of trees)WRACK: marine vegetation, especially: kelp; also, dried seaweeds
Flowers and Words about Flowers
ABLOOM: abounding with blooms: bloomingAMARANTH: a flower that never fadesANEMONE: any of a large genus (Anemone) of perennial herbs of the buttercup family having lobed or divided leaves and showy flowers without petals but with conspicuous sepals; called also windflowerANEMONE: any of a large genus (Anemone) of perennial herbs of the buttercup family having lobed or divided leaves and showy flowers without petals but with conspicuous sepals; called also windflowerAZALEA: any of a subgenus (Azalea) of rhododendrons with funnel-shaped corollas and usually deciduous leaves including many species and hybrid forms cultivated as ornamentalBLEW: blossoms; in bloom; also, to flower or bloom; fully-open flowers are “blown”BLOOM: a blossom or flower; also, the state of being in flower, or a period of flowering; also, to produce or yield flowersBLOOMED: a blossom or flower; also, the state of being in flower, or a period of flowering; also, to produce or yield flowersBLOOMING: a blossom or flower; also, the state of being in flower, or a period of flowering; also, to produce or yield flowersBLOW: blossoms; in bloom; also, to flower or bloom; fully-open flowers are “blown”BLOWING: blossoms; in bloom; also, to flower or bloom; fully-open flowers are “blown”BLOWN: blossoms; in bloom; also, to flower or bloom; fully-open flowers are “blown”BLUEBELL: any of various bellflowers, especially: HAREBELL; also, any of various plants bearing blue bell-shaped flowers: such as a European herb (Hyacinthoides nonscripta synonym Scilla nonscripta) of the lily family having scapose racemes of drooping bell-shaped flowers, or bluebells plural: a glabrous erect eastern U.S. herb (Mertensia virginica) of the borage family with entire leaves and showy blue flowers pink in the bud, called also Virginia bluebellsBLUEBOTTLE: the bachelor's button, a European composite (Centaurea cyanus) having flower heads with usually blue, pink, or white rays that is often cultivated in North America; called also cornflowerBOURBON: a rose (Rosa borboniana) of upright growth with shining leaves, prickly branches, and clustered large flowers; named after French rose de Bourbon, after the Île Bourbon (now Réunion, island of the western Mascarene Islands in the western Indian Ocean), where the rose likely originatedCALLA: short for calla lily: any of several herbs (genus Zantedeschia) of the arum family especially: a house or greenhouse plant (Z. aethiopica) with a white showy spathe and yellow spadixCAMELLIA: any of a genus (Camellia) of shrubs or trees of the tea family, esp. an ornamental greenhouse shrub (C. japonica) with glossy leaves and roselike flowers from New Latin Camellia, from Camellus (Georg Josef Kamel †1706 Moravian Jesuit missionary)CANNA: any of a genus (Canna of the family Cannaceae) of tropical herbs with simple stems, large leaves, and a terminal raceme of irregular flowersCHALICE: the cup-shaped interior of a flowerCOMPLETE: having all four sets of floral organsCONE: any of several flower or fruit clusters suggesting a coneCOROLLA: the part of a flower that consists of the separate or fused petals and constitutes the inner whorl of the perianthCORONA: an appendage or series of united appendages on the inner side of the corolla in some flowers (such as the daffodil, jonquil, or milkweed)CROCI: plural of crocus: any of a genus (Crocus) of herbs of the iris family developing from corms and having solitary long-tubed flowers and slender linear leavesDAHLIA: any of a genus (Dahlia) of American tuberous-rooted composite herbs having opposite pinnate leaves and rayed flower heads and including many that are cultivated as ornamentals; genus name, from Anders Dahl †1789 Swedish botanistDAYLILY: any of various Eurasian perennial herbs (genus Hemerocallis) of the lily family that have short-lived flowers resembling lilies and are widespread in cultivation and as escapesFALL: one of the three outer and often drooping segments of the flower of an irisFALLS: one of the three outer and often drooping segments of the flower of an irisFLAG: any of various monocotyledonous plants with long ensiform leaves: such as iris, any of a large genus (Iris of the family Iridaceae, the iris family) of perennial herbaceous plants with linear usually basal leaves and large showy flowers; especially a wild irisFLAX: any of a genus (Linum of the family Linaceae, the flax family) of herbs, especially: a slender erect annual (L. usitatissimum) with blue flowers commonly cultivated for its bast fiber and seedFLORAL: of, relating to, or depicting flowers; from Flōra "the goddess Flora"FLORALLY: M-W does not have an entry for florallyFOXGLOVE: any of a genus (Digitalis) of erect herbs of the snapdragon family, especially: a common European biennial or perennial (D. purpurea) cultivated for its showy racemes of dotted white or purple tubular flowers and as a source of digitalisGLAD: short for gladiolus: any of a genus (Gladiolus) of chiefly African perennial plants of the iris family with erect sword-shaped leaves and spikes of brilliantly colored irregular flowers arising from cormsGLADIOLI: plural of gladiolus: any of a genus (Gladiolus) of chiefly African perennial plants of the iris family with erect sword-shaped leaves and spikes of brilliantly colored irregular flowers arising from cormsHEPATIC: any of a genus (Hepatica) of perennial herbs of the buttercup family with lobed leaves and delicate flowers, especially: a small herb (Hepatica nobilis synonym Anemone hepatica) of northern temperate woodlands that has small purple, pink, blue, or white flowersHYACINTH: a bulbous perennial herb (Hyacinthus orientalis) of the lily family that is native to the Mediterranean region but is widely grown for its dense spikes of fragrant flowersINNOCENCE: a bluet, any of several perennial North American herbs (genus Hedyotis synonym Houstonia) of the madder family, especially: one (Hedyotis caerulea synonym Houstonia caerulea) having tufted stems and bluish, white, or purplish flowers with yellow centersLILY: any of a genus (Lilium of the family Liliaceae, the lily family) of erect perennial leafy-stemmed bulbous herbs that are native to the temperate northern hemisphere and are widely cultivated for their showy flowers; broadly: any of various plants of the lily family or of the related amaryllis or iris families; also, any of various plants with showy flowers: such as a scarlet anemone (Anemone coronaria) of the Mediterranean region; the water lily; or the calla lilyLIMB: the expanded portion of an organ or structure, especially: the upper spreading portion of a corolla (as of the phlox) whose lower part consists of a tube of fused petals;ORCHID: any of a large family (Orchidaceae, the orchid family) of perennial epiphytic or terrestrial monocotyledonous plants that usually have showy 3-petaled flowers with the middle petal enlarged into a lip and differing from the others in shape and colorPEONY: any of a genus (Paeonia of the family Paeoniaceae) of chiefly Eurasian plants with large often double flowers; also, the flower of a peony; from Greek paiōnia, from Paiōn Paeon, physician of the godsPETAL: one of the modified often brightly colored leaves of the corolla of a flowerPINK: any of a genus (Dianthus of the family Caryophyllaceae, the pink family) of chiefly Eurasian herbs having usually pink, red, or white flowersPOPPY: any of a genus (Papaver of the family Papaveraceae, the poppy family) of chiefly annual or perennial herbs with milky juice, showy regular flowers, and capsular fruits including the opium poppy and several forms cultivated as ornamentalsRAGWORT: any of several senecios, especially: tansy ragwortTULIP: any of a genus (Tulipa) of Eurasian bulbous herbs of the lily family that have linear or broadly lanceolate leaves and are widely grown for their showy flowers; also, the flower or bulb of a tulipVIOLA: a violet, any of a genus (Viola of the family Violaceae, the violet family) of chiefly herbs with alternate stipulate leaves and showy flowers in spring and often cleistogamous flowers in summer; especially: one with smaller usually solid-colored flowers as distinguished from the usually larger-flowered violas and pansies; especially: any of various garden hybrids with solitary white, yellow, or purple often variegated flowers resembling but smaller than typical pansies VIOLET: any of a genus (Viola of the family Violaceae, the violet family) of chiefly herbs with alternate stipulate leaves and showy flowers in spring and often cleistogamous flowers in summer, especially: one with smaller usually solid-colored flowers as distinguished from the usually larger-flowered violas and pansies; also, any of several plants of genera other than that of the violet YARROW: a widely naturalized strong-scented Eurasian composite herb (Achillea millefolium) with finely dissected leaves and small usually white corymbose flowers; also: any of several congeneric plantsYUCCA: any of a genus (Yucca) of sometimes arborescent plants of the asparagus family that occur in warm regions chiefly of western North America and have long sword-shaped often stiff fibrous-margined leaves on a usually woody base and bear a large panicle of white blossomsZINNIA: any of a genus (Zinnia) of tropical American composite herbs and low shrubs that have showy flower heads with long-lasting ray flowers, from Johann G. Zinn †1759 German botanist
Fungi, Molds, etc.
BUTTON: an immature whole mushroom, especially: a button mushroomCONK: the visible fruiting body of a bracket fungus; also: decay caused by such a fungusFUNGAL: of, relating to, or having the characteristics of fungiFUNGI: plural of fungus, any of a kingdom (Fungi) of saprophytic and parasitic spore-producing eukaryotic typically filamentous organisms formerly classified as plants that lack chlorophyll and include molds, rusts, mildews, smuts, mushrooms, and yeastsGILL: one of the radiating plates forming the undersurface of the cap of a mushroom fungusLAMELLA*: a gill of a mushroomLAMELLAE*: plural of lamella, a gill of a mushroomMILDEW: a superficial usually whitish growth produced especially on organic matter or living plants by fungi (as of the families Erysiphaceae and Peronosporaceae); also, a fungus producing mildew; also, a discoloration caused by fungi; also, to affect with or as if with mildew or to become affected with mildewMILDEWED: a superficial usually whitish growth produced especially on organic matter or living plants by fungi (as of the families Erysiphaceae and Peronosporaceae); also, a fungus producing mildew; also, a discoloration caused by fungi; also, to affect with or as if with mildew or to become affected with mildewMOLD: a superficial often woolly growth produced especially on damp or decaying organic matter or on living organisms by a fungus (as of the order Mucorales); also, a fungus that produces mold; also, to become moldyMOLDED: a superficial often woolly growth produced especially on damp or decaying organic matter or on living organisms by a fungus (as of the order Mucorales); also, a fungus that produces mold; also, to become moldyMOLDING: a superficial often woolly growth produced especially on damp or decaying organic matter or on living organisms by a fungus (as of the order Mucorales); also, a fungus that produces mold; also, to become moldyMOLDY: of, resembling, or covered with mold
Grasses
ALFALFA: a deep-rooted leguminous perennial plant (Medicago sativa) of southwestern Asia that is widely grown for hay and forageBAMBOO: any of various woody or arborescent grasses (as of the genera Bambusa, Arundinaria, and Dendrocalamus of the subfamily Bambusoideae) of tropical and temperate regions having hollow stems, thick rhizomes, and shoots that are used for foodBENT: a reedy grass or a stalk of stiff coarse grass; also, any of a genus (Agrostis) of grasses including important chiefly perennial and rhizomatous pasture and lawn grasses with fine velvety or wiry herbageCANE: any of various tall woody grasses or reeds; also, any of a genus (Arundinaria) of bamboo; also, sugarcane, a stout tall perennial grass (Saccharum officinarum) native to tropical southeast Asia that has a large terminal panicle and is widely grown in warm regions as a source of sugar; also, sorghum, any of an economically important genus (Sorghum) of Old World tropical grasses similar to corn in habit but with the spikelets in pairs on a hairy rachis, especially: any of various cultivars (such as grain sorghum or sorgo) derived from a wild form (S. bicolor synonym S. vulgare)CHEAT: cheatgrass, an annual weedy Eurasian bromegrass (Bromus tectorum) naturalized in north America (M-W: “probably from a deceptive resemblance to grain”)CORN: a tall annual cereal grass (Zea mays) originally domesticated in Mexico and widely grown for its large elongated ears of starchy seeds (this def follows the def for British corn)CORNCOB: the core on which the kernels of corn are arranged, or an ear of cornDURUM: a wheat (Triticum durum) that yields a glutenous flour used especially in pasta; called also durumGRAIN: a seed or fruit of a cereal grass: a caryopsis, a small one-seeded dry indehiscent fruit (as of corn or wheat) in which the fruit and seed fuse in a single grain; also, plants producing grainGRAMMA: M-W: variant spelling of grama, any of several pasture grasses (genus Bouteloua) of the western U.S.MAIZE: a tall annual cereal grass (Zea mays) originally domesticated in Mexico and widely grown for its large elongated ears of starchy seeds; cornMILLET: any of various small-seeded annual cereal and forage grasses, such as a Eurasian grass (Panicum miliaceum) cultivated for its grain which is used for food, or any of several grasses related to common millet; also, the seed of a milletTEFF: an economically important Ethiopian annual cereal grass (Eragrostis tef synonym E. abyssinica) grown for its small grain which yields a white flour and as a forage and hay cropTWITCH: quack grass: a European grass (Elymus repens synonym Agropyron repens) that is naturalized throughout North America and spreads by creeping rhizomes; called also couch grass, quitch, twitch, witchgrassWHEAT: a cereal grain that yields a fine white flour used chiefly in breads, baked goods (such as cakes and crackers), and pastas (such as macaroni or spaghetti), and is important in animal feeds; also, any of various Old World annual grasses (genus Triticum, especially T. aestivum and T. turgidum) of wide climatic adaptability that are cultivated in most temperate areas for the wheat they yield
Legumes
BEAN: the seed of any of various erect or climbing plants (as of the genera Phaseolus and Vigna) of the legume family other than the fava bean, or a a plant bearing beansFAVA: the fava bean or broad bean: the large, flat, edible, starchy seed of an Old World upright vetch (Vicia faba) that is typically pale green to whitish in color and is eaten raw, blanched, or cooked; also: this plant widely grown for its seeds and as fodder [and soil dressing[GARBANZO: the chickpea, an Asian herb (Cicer arietinum) of the legume family cultivated for its short pods with one or two seedsGRAM: any of several leguminous plants (such as a chickpea) grown especially for their seed; also: their seedsGUAR: a drought-tolerant legume (Cyamopsis tetragonoloba) cultivated in warm regions as a vegetable, for forage, and for its seeds which produce guar gumLENTIL: a widely cultivated Eurasian annual leguminous plant (Lens culinaris) with flattened edible seeds and leafy stalks used as fodder; also, the seed of the lentilLIMA: M-W has only lima bean, a bushy or vining tropical American bean (Phaseolus lunatus synonym Phaseolus limensis) that is widely cultivated for its flat edible starchy seed which is usually pale green when immature and whitish or beige when mature; also, the seed of a lima bean eaten usually cooked as a vegetable, named for Lima, PeruLOCO: any of several leguminous plants (genera Astragalus and Oxytropis) of western North America that contain a toxin that causes locoism especially in livestock when ingested in large quantities: locoweed; also, to poison with locoweedLOCOWEED: any of several leguminous plants (genera Astragalus and Oxytropis) of western North America that contain a toxin that causes locoism especially in livestock when ingested in large quantities; called also locoLUPINE: any of a genus (Lupinus) of leguminous herbs including some poisonous forms and others cultivated for their long showy racemes of usually blue, purple, white, or yellow flowers or for green manure, fodder, or their edible seeds; also: an edible lupine seedMEDIC: any of a genus (Medicago) of leguminous herbs (such as alfalfa)MUNG: M-W has mung bean, an erect bushy annual bean (Vigna radiata synonym Phaseolus aureus) that is widely cultivated in warm regions for its edible usually green or yellow seeds, for forage, and as the chief source of bean sproutsPEANUT: a low-branching widely cultivated annual herb (Arachis hypogaea) of the legume family with showy yellow flowers having a peduncle which elongates and bends into the soil where the ovary ripens into a pod containing one to three oily edible seeds; also: its seed or seed-containing pod
Other Plants
AGAVE: any of a genus (Agave of the family Agavaceae, the agave family) of plants having spiny-margined leaves and flowers in tall spreading panicles and including some cultivated for their fiber or sap or for ornamentALLIUM: any of a large genus (Allium) of bulbous herbs of the amaryllis family that includes the onion, garlic, chive, and leekALOE: any of a large genus (Aloe) of succulent chiefly southern African plants of the lily family with basal leaves and spicate flowers; also, the dried juice of the leaves of various aloes used especially formerly as a purgative —Used in Plural but singular in construction (this is not aloe vera)AMARANTH: any of a large genus (Amaranthus of the family Amaranthaceae, the amaranth family) of coarse annual herbs with clusters of small green, dark pink, red, or purplish flowers and including forms cultivated as food crops and various pigweedsANGELICA: any of a genus (Angelica) of herbs of the carrot family, esp. a Eurasian biennial or perennial (A. archangelica) whose roots and seeds yield a flavoring oil and whose young stems are often candiedARNICA: any of a genus (Arnica) of composite herbs including some with bright yellow ray flowersARROWROOT: any of a genus (Maranta of the family Marantaceae, the arrowroot or prayer plant family) of tropical American plants that typically have tuberous roots: Maranta, especially: one (M. arundinacea) whose roots yield an easily digested edible starchARUGULA: a yellowish-flowered Mediterranean herb (Eruca vesicaria sativa) of the mustard family cultivated for its foliage, used especially in saladsARUM: any of a genus (Arum of the family Araceae, the arum family) of Eurasian plants having usually arrow-shaped leaves and a showy spathe partially enclosing a spadixBALM: any of several aromatic plants of the mint family especially: lemon balmBANANA: any of several widely cultivated perennial often treelike herbs (genus Musa of the family Musaceae, the banana family) bearing bananas in compact pendent bunchesBEET: a biennial garden plant (Beta vulgaris) of the amaranth family that includes several cultivars (such as Swiss chard and sugar beet) and that has thick edible leaves with long petioles and often swollen purplish-red roots; also: its root used especially as a vegetable, as a source of sugar, or for forageBETEL: a climbing pepper (Piper betle) of SE Asia whose leaves are chewed together with betel nut and mineral lime as a stimulant masticatoryBLACKCAP: a black raspberry; a raspberry (Rubus occidentalis) of eastern North America that has a purplish-black fruit and is the source of several cultivated varietiesCACTI: plural of cactus, any of a family (Cactaceae, the cactus family) of plants that have succulent stems and branches with scales or spines instead of leaves and are found especially in dry areas (such as deserts)CALLA: short for calla lily: any of several herbs (genus Zantedeschia) of the arum familyCALLALOO: the edible young green leaves of a plant (such as taro or a member of the genus Xanthosoma) of the arum family used as greensCANNA: any of a genus (Canna of the family Cannaceae) of tropical herbs with simple stems, large leaves, and a terminal raceme of irregular flowersCANOLA: a rape [mustard] plant of an improved variety having seeds that are low in erucic acid and are the source of canola oil. Canola was originally a trademark name of the Rapeseed Association of Canada, and the name was a condensation of "Can" from Canada and "OLA" meaning "Oil, low acid" but is now a generic term for edible varieties of rapeseed oil in North America and Australasia.CARAWAY: a biennial usually white-flowered aromatic Old World herb (Carum carvi) of the carrot familyCARROT: a biennial herb (Daucus carota of the family Umbelliferae, the carrot family) with a usually orange spindle-shaped edible rootCATMINT: any of a genus (Nepeta) of Old World temperate-zone herbs of the mint familyCATNIP: a strong-scented perennial mint (Nepeta cataria) that has whorls of small pale flowers in terminal spikes and contains a substance attractive to catsCATTAIL: any of a genus (Typha of the family Typhaceae, the cattail family) of tall reedy marsh plants with brown furry fruiting spikesCAYENNE: any of several cultivated peppers of a variety (Capsicum annuum longum) with very long twisted pungent red fruitsCHARD: Swiss chard; a beet (Beta vulgaris cicla) having large leaves and succulent stalks often cooked as a vegetableCHIA: an annual herb (Salvia hispanica) of the mint family that is native to Mexico and Guatemala, has spikes of blue, purple, or white flowers, and is grown for its grayish, edible, mucilaginous seeds which are eaten whole or used especially to make a beverage or oilCHICORY: a thick-rooted usually blue-flowered European perennial composite herb (Cichorium intybus) widely grown for its roots and as a salad plantCHILI: a hot pepper of any of a group of cultivars (Capsicum annuum annuum group longum) noted for their pungencyCICELY: any of several herbs of the family Umbelliferae. The name derives from the seseli, not the other way around. Not an eponym.CLOTBUR: a burdock; any of a genus (Arctium) of coarse composite herbs bearing globular flower heads with prickly bractsCOCKLE: any of several weedy plants of the pink family, especially corn cockleCOFFEE: any of several Old World tropical plants (genus Coffea and especially C. arabica and C. canephora) of the madder family that are widely cultivated in warm regions for their seeds from which coffee is preparedCOLLARD: a cabbage (Brassica oleracea acephala) related to kale and having a loose head of stalked smooth leavesCOTTON: various erect freely branching tropical plants (genus Gossypium) of the mallow familyCUBE: or cubé: any of several tropical American plants (genus Lonchocarpus) furnishing rotenoneCUKE: short for cucumber, a vine (Cucumis sativus) of the gourd family cultivated as a garden vegetable, or the vine itselfCUMIN: a small annual herb (Cuminum cyminum) of the carrot family cultivated for its aromatic fruits DILL: any of several plants of the carrot family, especially: a European herb (Anethum graveolens) with aromatic foliage and seeds both of which are used in flavoring foods and especially picklesDOCK: any of a genus (Rumex) of coarse weedy plants of the buckwheat family having long taproots and sometimes used as potherbs; also, any of several usually broad-leaved weedy plants (as of the genus Silphium)EGGPLANT: a widely cultivated perennial Asian herb (Solanum melongena) of the nightshade family yielding edible fruitENDIVE: an annual or biennial composite herb (Cichorium endivia) that is closely related to chicory and occurs in two common varietiesFENNEL: a perennial Eurasian herb (Foeniculum vulgare) that has clusters of small yellow flowers and aromatic leaves and seeds and includes several cultivated formsFLAG: sweet flag, any of a genus (Acorus of the family Acoraceae) of perennial herbaceous plants that are typically found in wetlands of the northern hemisphere and have long narrow leaves and aromatic roots; especially: an Asian plant (Acorus calamus) that has been introduced to Europe and North America that has been used especially formerly as a flavoring agent and in alternative medicine but is now banned for these uses in several countries because of its potential carcinogenic effects and toxicity: calamusGALANGAL: either of two eastern Asian perennial herbs (Alpinia galanga and A. officinarum) of the ginger family with dark green sword-shaped leaves and pungent aromatic rhizomesGARLIC: a European allium (Allium sativum) widely cultivated for its pungent compound bulbs much used in cookery; or a bulb of garlicGOURD: any of a family (Cucurbitaceae, the gourd family) of chiefly herbaceous tendril-bearing vines including the cucumber, melon, squash, and pumpkin, or the fruit of a gourdHAND: a cluster of bananas developed from a single flower group; also, a branched rootstock of ginger; also, a bunch of large leaves (as of tobacco) tied together usually with another leafHEATH: any of a family (Ericaceae, the heath family) of shrubby dicotyledonous and often evergreen plants that thrive on open barren usually acid and ill-drained soil, especially: an evergreen subshrub of either of two genera (Erica and Calluna) with whorls of needlelike leaves and clusters of small flowers; also, any of various plants that resemble true heathsHEMLOCK: any of several poisonous herbs (such as a poison hemlock or a water hemlock) of the carrot family having finely cut leaves and small white flowersHEMP: a tall widely cultivated Asian herb (Cannabis sativa of the family Cannabaceae, the hemp family) that is cultivated for its tough bast fiber and edible seeds and oil and that is often separated into a tall loosely branched species (C. sativa) and a low-growing densely branched species (C. indica)
HENBANE: a poisonous fetid Eurasian herb (Hyoscyamus niger) of the nightshade family with yellowish-brown flowers and sticky hairy leaves that yield hyoscyamine and scopolamineHONEYDEW: the honeydew melon, a pale smooth-skinned winter melon with sweet greenish fleshINDICA: M-W has this only as part of the phrase “cannabis indica” -- a variety of cannabis obtained in IndiaINDIGO: a plant that yields indigo, especially: any of a genus (Indigofera) of leguminous herbs; Italian dialect, from Latin indicum, from Greek indikon, from neuter of indikos Indic, from Indos IndiaIPECAC: the dried rhizome and roots of either of two tropical American plants (Cephaelis acuminata and C. ipecacuanha) of the madder family used especially as a source of emetine; aloo: either of these plantsKALE: a hardy cabbage (Brassica oleracea acephala) with curled often finely incised leaves that do not form a dense head; also: its leaves used as a vegetableLEEK: a biennial herbaceous plant (Allium porrum synonym A. ampeloprasum var. porrum) of the amaryllis family that is related to the garlic, onion and chive and is commonly grown as an annual for its mildly pungent linear leaves and especially for its cylindrical stemlike lower sheath of leavesLETTUCE: any of a genus (Lactuca) of composite plants, especially: a common garden vegetable (L. sativa) whose succulent leaves are used especially in saladsLOOFA: Collins: another name for loofah, any of a genus (Luffa) of Old World tropical plants of the gourd family with white to yellow flowers and large usually elongate fruits that are sometimes eaten as vegetables when immature; also: the fruit of a loofah LOOFAH: Collins also has loofa, any of a genus (Luffa) of Old World tropical plants of the gourd family with white to yellow flowers and large usually elongate fruits that are sometimes eaten as vegetables when immature; also: the fruit of a loofah LOOFAS: Collins also has loofa, any of a genus (Luffa) of Old World tropical plants of the gourd family with white to yellow flowers and large usually elongate fruits that are sometimes eaten as vegetables when immature; also: the fruit of a loofah LOVAGE: any of several aromatic perennial herbs of the carrot family, especially: a European herb (Levisticum officinale) sometimes cultivated for use in medicine especially as a diuretic and in cookery usually as a flavoring agent; derived [ultimately] from the Latin for LigurianMALLOW: any of a genus (Malva of the family Malvaceae, the mallow family) of herbs with palmately lobed or dissected leaves, usually showy flowers, and a disk-shaped fruitMANGO: a pepper plant (Capsicum annuum) bearing sweet peppersMARIJUANA: cannabis or hemp, a tall widely cultivated Asian herb (Cannabis sativa of the family Cannabaceae, the hemp family) that is cultivated for its tough bast fiber and edible seeds and oil and that is often separated into a tall loosely branched species (C. sativa) and a low-growing densely branched species (C. indica)MIGNONETTE: any of a genus (Reseda of the family Resedaceae, the mignonette family) of herbs, especially: a garden annual (R. odorata) bearing racemes of fragrant whitish flowersMINT: any of a family (Lamiaceae synonym Labiatae, the mint family) of aromatic plants with a square stem and a 4-lobed ovary which produces four one-seeded nutlets in fruit, especially: any of a genus (Mentha) of mints that have white, purple, or pink verticillate flowers with a nearly regular corolla and four equal stamens and that include some used in flavoring and cookeryNAIAD: any of a genus (Najas of the family Hydrocharitaceae) of submerged aquatic plantsNETTLE: any of a genus (Urtica of the family Urticaceae, the nettle family) of chiefly coarse herbs armed with stinging hairs; also, any of various prickly or stinging plants other than the true nettles (genus Urtica)OCOTILLO*: a thorny scarlet-flowered candlewood (Fouquieria splendens of the family Fouquieriaceae) of the southwestern U.S. and MexicoOKRA: a tall annual herb (Abelmoschus esculentus) of the mallow family that is cultivated for its mucilaginous green pods used especially in soups or stews; also: the pods of this plantONION: a widely cultivated Asian herbaceous plant (Allium cepa) of the amaryllis family that has a pungent edible bulb and that is closely related to the garlic, chive, and leek; also: its bulb; also, any of various usually ornamental alliums (such as Allium amplectens or A. caeruleum) related to the onionPAPYRI: plural of papyrus, a tall perennial sedge (Cyperus papyrus) of the Nile valleyPEYOTE: a small, low, spineless cactus (Lophophora williamsii) of Mexico and southern Texas that has bluish- to grayish-green dome-shaped stems having jointed disk-shaped tubercles with tufts of woolly white hairs and that contains psychoactive alkaloids; also called mescalPINE: the pineapple, a tropical monocotyledonous plant (Ananas comosus of the family Bromeliaceae, the bromeliad family) that has rigid spiny-margined recurved leaves and a short stalk with a dense oblong head of small abortive flowersPINEAPPLE: a tropical monocotyledonous plant (Ananas comosus of the family Bromeliaceae, the bromeliad family) that has rigid spiny-margined recurved leaves and a short stalk with a dense oblong head of small abortive flowersPINOT: any of several purple or white vinifera grapes used for wine-makingPITA: any of several fiber-yielding plants (such as an agave)PLANTAIN: a banana plant (Musa paradisiaca); also, any of a genus (Plantago of the family Plantaginaceae, the plantain family) of herbs with basal rosettes of usually lanceolate or elliptical leaves and spikes of minute greenish flowersPOKE: pokeweed: a poisonous American perennial herb (Phytolacca americana of the family Phytolaccaceae, the pokeweed family) with racemose white flowers, dark purple juicy berries, and young shoots sometimes used as potherbsPOTATO: an erect South American herb (Solanum tuberosum) of the nightshade family widely cultivated for its edible starchy tuber; also, the tuber of a potato; also, a sweet potato, a tropical vine (Ipomoea batatas) of the morning-glory family that is often grown for its edible tuberous root or for its ornamental variously shaped green to purple leaves and usually white to pinkish funnel-shaped flowers with pink to purple centers; also: the large thick sweet and nutritious tuberous root of the sweet potato that has beige, yellow, orange, red, or purple flesh and is cooked and eaten as a vegetable.PUMPKIN: a fruit of any of various cultivars of herbaceous plants (Cucurbita pepo, C. maxima, C. moschata, C. ficifolia, and C. argyrosperma) of the gourd family that is typically round and orange but may be another color or shape, that has a hard usually smooth skin with shallow longitudinal grooves, and that is grown for ornamental use or for its fibrous pale flesh used especially in baking or as feed for livestock; also, any of several annual chiefly trailing American plants that bear pumpkinsRAMP: any of various alliums used for foodRAPINI: broccoli rabe, a garden brassica (Brassica rapa ruvo) that is related to the turnip and produces edible leafy branching stalks and compact clusters of yellow floretsRATTAN: a climbing palm (especially of the genus Calamus) with very long tough stemsTANGLE: a large seaweedTAPIOCA: cassava: any of several American plants (genus Manihot, especially M. esculenta) of the spurge family grown in the tropics for their edible tuberous roots which yield a nutritious starch; also: the rootTARO: a tropical Asian plant (Colocasia esculenta) of the arum family that has large heart- or arrow-shaped leaves and is grown throughout the tropics for its edible starchy corms and cormels and in temperate regions for ornament; also: its corms and cormels typically cooked as a vegetable or ground into flourTARRAGON: a small widely cultivated perennial artemisia (Artemisia dracunculus) having aromatic narrow usually entire leaves; also: its leaves used as a seasoningTHRIFT: any of a genus (Armeria) of low-growing perennial evergreen herbs of the plumbago family, especially, a tufted herb (A. maritima) with pink or white flower heads THYME: any of a genus (Thymus) of Eurasian mints with small pungent aromatic leaves especially: a Mediterranean garden herb (T. vulgaris)TOBACCO: any of a genus (Nicotiana) of chiefly American plants of the nightshade family with viscid foliage and tubular flowers, especially: a tall erect annual tropical American herb (N. tabacum) cultivated for its leavesTOMATILLO: the small round yellow, purplish, and especially pale green edible sticky fruit of a Mexican ground-cherry (Physalis philadelphica synonym P. ixocarpa); also: the plant that bears tomatillosTOMATO: a plant that produces tomatoes, especially: any of various varieties of a tender perennial (Solanum lycopersicum synonym Lycopersicon esculentum) widely cultivated as an annualTUNA: any of various flat-jointed prickly pears (genus Opuntia), especially: one (O. tuna) of tropical America; also, the edible fruit of a tunaVANILLA: any of a genus (Vanilla) of tropical American climbing epiphytic orchidsVINE: any of various sprawling herbaceous plants (such as a tomato or potato) that lack specialized adaptations for climbing; also, the grape, any of numerous woody vines (genus Vitis of the family Vitaceae, the grape family) that usually climb by tendrils, produce grapes, and are nearly cosmopolitan in cultivationWEED: an aquatic plant, especially: seaweedWORT: a plant, especially: an herbaceous plant —usually used in combination (ragwort, lungwort, St John’s wort)YUCA: cassava: any of several American plants (genus Manihot, especially M. esculenta) of the spurge family grown in the tropics for their edible tuberous roots which yield a nutritious starch; also, the root, called also mandioca, manioc, yuca, yuccaYUCCA: cassava: any of several American plants (genus Manihot, especially M. esculenta) of the spurge family grown in the tropics for their edible tuberous roots which yield a nutritious starch; also, the root, called also mandioca, manioc, yuca, yucca
Plant Disease
BLIGHT: a disease or injury of plants marked by the formation of lesions, withering, and death of parts (such as leaves and tubers), also, an organism (such as an insect or a fungus) that causes blightBLIND: of plants: defective, lacking a growing point or producing leaves instead of flowersEDEMA: watery swelling of plant organs or parts; any of various plant diseases characterized by such swellingsGALL: an abnormal outgrowth of plant tissue usually due to insect or mite parasites or fungi and sometimes forming an important source of tanninGALL: an abnormal outgrowth of plant tissue usually due to insect or mite parasites or fungi and sometimes forming an important source of tanninHALOING: [not in M-W] the development of light-colored bands or edges on the leaves of certain plants due to soil conditionsMOTTLE: mosaic: any of numerous virus diseases of plants characterized by diffuse light and dark green or yellow and green mottling of the foliageNUBBIN: something (such as an ear of corn) that is small for its kind, stunted, undeveloped, or imperfectWART: an excrescence or protuberance resembling a wart, especially: a glandular excrescence or hardened protuberance on a plantWARTY: an excrescence or protuberance resembling a wart, especially: a glandular excrescence or hardened protuberance on a plantWILT: to lose turgor from lack of water (the plants wilted in the heat); also, a disorder (such as a fungus disease) of plants marked by loss of turgidity in soft tissues with subsequent drooping and often shriveling ( called also wilt disease)WOUND: a cut or breach in a plant usually due to an external agent
Plant Morphology including words about wood
ANNULI: plural of annulus: “a part, structure, or marking resembling a ring: such as a line of cells around a fern sporangium that ruptures the sporangium by contracting”APPLE: a fruit (such as a star apple) or other vegetative growth (such as an oak apple) suggestive of an appleARIL: an exterior covering or appendage of some seeds (as of the yew) that develops after fertilization as an outgrowth from the ovule stalkAXIAL: botany: of, relating to, or having the characteristics of an axis, or situated around, in the direction of, on, or along an axis, a plant stemAXIALLY: botany: of, relating to, or having the characteristics of an axis, or situated around, in the direction of, on, or along an axis, a plant stemBARK: the tough exterior covering of a woody root or stemBEAN: the seed of any of various erect or climbing plants (as of the genera Phaseolus and Vigna) of the legume family other than the fava bean, or a a plant bearing beansBELL: the corolla of a flowerBLOOM: a delicate powdery coating on some fruits and leavesBODY: the organized physical substance of an animal or plant either living or dead; also, the main part of a plant or animal body especially as distinguished from limbs and head: the trunkBOLL: the usually roundish pod or capsule of some plants (such as cotton or flax)BOLLS: the usually roundish pod or capsule of some plants (such as cotton or flax)
BOOT: a sheath enclosing the inflorescence [of grasses]BOUGH: a branch of a treeBRANCH: botany: a natural subdivision of a plant stem, especially: a secondary shoot or stem (such as a bough) arising from a main axis (as of a tree); also, to put forth secondary shoots or stems: to put forth branchesBRANCHY: botany: a natural subdivision of a plant stem, especially: a secondary shoot or stem (such as a bough) arising from a main axis (as of a tree); also, to put forth secondary shoots or stems: to put forth branchesBUDDED: verb to bud: to set or put forth buds; to commence growth from buds; to grow or develop from or as if from a bud; to reproduce asexually especially by the pinching off of a small part of the parent; to produce or develop from buds; to cause (a plant) to bud; to insert a bud from a plant of one kind into an opening in the bark of (a plant of another kind) usually in order to propagate a desired varietyBUDDING: verb to bud: to set or put forth buds; to commence growth from buds; to grow or develop from or as if from a bud; to reproduce asexually especially by the pinching off of a small part of the parent; to produce or develop from buds; to cause (a plant) to bud; to insert a bud from a plant of one kind into an opening in the bark of (a plant of another kind) usually in order to propagate a desired varietyBULB: a resting stage of a plant (such as the lily, onion, hyacinth, or tulip) that is usually formed underground and consists of a short stem base bearing one or more buds enclosed in overlapping membranous or fleshy leaves; also, a fleshy structure (such as a tuber or corm) resembling a bulb in appearance; also, a plant having or developing from a bulbBURL: a hard woody often flattened hemispherical outgrowth on a treeBURR: a tree burlBURR: usually bur: a rough or prickly envelope of a fruit, or a plant that bears bursBUTT: the base of a plant from which the roots springBUTTON: any of various parts or growths of a plant or of an animal: such as a budCANDLE: a thin, upright new shoot forming from a terminal bud on a pine tree in the springCANE: a hollow or pithy, usually slender, and often flexible jointed stem (as of a reed or bamboo) (e.g., a fishing pole made of cane); also, any of various slender woody stems especially: an elongated flowering or fruiting stem (as of a rose) usually arising directly from the groundCATKIN: a spicate inflorescence (as of the willow, birch, or oak) bearing scaly bracts and unisexual usually apetalous flowers, from its resemblance to a cat's tailCHALICE: the cup-shaped interior of a flowerCHLOROPHYLL: the green photosynthetic pigment found chiefly in the chloroplasts of plants…CIRRI: plural of cirrus: a tendril; a leaf, stipule, or stem modified into a slender spirally coiling sensitive organ serving to attach a climbing plant to its support, such as an arm of a barnacle…CLEFT: of leaves: partially split or divided; specifically: divided about halfway to the midribCOBS: plural of cob, a corncob, the core on which the kernels of corn are arrangedCOIR: the outer fibrous husk of the coconut palm COLLECTIVE: of a fruit: multiple, formed by coalescence of the ripening ovaries of several flowersCOMA: a tufted bunch (as of branches, bracts, or seed hairs)COMPLETE: having all four sets of floral organsCOMPOUND: of leaves: having the blade divided to the midrib and forming two or more leaflets on a common axisCONE: a mass of ovule-bearing or pollen-bearing scales or bracts in most conifers or in cycads that are arranged usually on a somewhat elongated axisCORK: phellem: a layer of usually suberized cells produced outwardly by a phellogen, or the elastic tough outer tissue of the cork oak that is used especially for stoppers and insulationCORKY: resembling cork, that is, phellem: a layer of usually suberized cells produced outwardly by a phellogen, or the elastic tough outer tissue of the cork oak that is used especially for stoppers and insulationCOROLLA: the part of a flower that consists of the separate or fused petals and constitutes the inner whorl of the perianthCORONA: an appendage or series of united appendages on the inner side of the corolla in some flowers (such as the daffodil, jonquil, or milkweed)COTTON: a downy cottony substance produced by various plants (such as the cottonwood)CROTCH: an angle formed by the parting of two legs, branches, or membersCUPULE*: a cup-shaped anatomical structure [in some trees and ferns]CURL: to grow in coils or spirals; also, a curved or spiral marking in the grain of woodCURL: a curved or spiral marking in the grain of woodCURLY: having the [wood] grain composed of fibers that undulate without crossing and that often form alternating light and dark lines (as in curly maple)CUTICLE: a thin continuous fatty or waxy film on the external surface of many higher plants that consists chiefly of cutinDEADWOOD: wood dead on the tree DEFINITE: of floral organs: being constant in number, usually less than 20, and occurring in multiples of the petal number; also, cymoseDIVIDED: of a leaf: cut into distinct parts by incisions extending to the base or to the midribDUCT: a tube or elongated cavity (such as a xylem vessel) in plant tissueETHYLENE: a colorless flammable gaseous unsaturated hydrocarbon C2H4 that … occurs in plants functioning especially as a natural growth regulator that promotes the ripening of fruitFANCILY: fancy: of an animal or plant: bred especially for bizarre or ornamental qualities that lack practical utilityFEMALE: botany: having or producing only pistils or pistillate flowers; also, a pistillate plantFLAGELLA: plural of flagellum, any of various elongated filiform appendages of plants or animalsFLOAT: a sac containing air or gas and buoying up the body of a plant or animalFORMIC: M-W has only the open compounds formic acid (a colorless pungent fuming vesicant liquid acid CH2O2 found especially in ants and in many plants and used chiefly in dyeing and finishing textiles) and formic aldehyde (formaldehyde)FROND: a large leaf (especially of a palm or fern) usually with many divisions, or a thallus or thalloid shoot (as of a lichen or seaweed) resembling a leafFRUIT: a product of fertilization in a plant with its modified envelopes or appendages; specifically: the ripened ovary of a seed plant and its contents; also, a product of plant growth (such as grain, vegetables, or cotton); also, the usually edible reproductive body of a seed plant, especially: one having a sweet pulp associated with the seedGLAND: any of various secreting organs (such as a nectary) of plantsGNARL: a hard protuberance with twisted grain on a treeGNARLY: gnarled, as in gnarly branchesGRAIN: the stratification of the wood fibers in a piece of woodGUMMED: to exude or form gum (as from a tree); to become gummyGUMMING: to exude or form gum (as from a tree); to become gummyHAIR: a filamentous structure that resembles hair (e.g., leaf hair)HAIRY: of plants: having a downy fuzz on the stems and leavesHAND: a cluster of bananas developed from a single flower group; also, a branched rootstock of ginger; also, a bunch of large leaves (as of tobacco) tied together usually with another leafHEAD: a capitulum: a racemose inflorescence (as of the sunflower) with the axis shortened and dilated to form a rounded or flattened cluster of sessile flowers; also, the foliaged part of a plant especially when consisting of a compact mass of leaves, flowers, or fruit; also, to form a compact mass of leaves or fruit: to form a head (e.g., this type of cabbage heads early)HEADED: to form a compact mass of leaves or fruit: to form a head (e.g., this type of cabbage heads early)HOAR: botany: covered with fine grayish or whitish hairs: canescentHOARY: botany: covered with fine grayish or whitish hairs: canescentHOODED: having a hood (hooded ladies-tresses) or shaped like a hood (hooded spathes) HULL: the outer covering of a fruit or seed; also, the persistent calyx or involucre that subtends some fruits (such as a strawberry)JOINT: a node, the point on a stem at which a leaf or leaves are insertedJOINT: in plants: to form joints as a stage in growth, used especially of small grainsJOINTED: in plants: to form joints as a stage in growth, used especially of small grainsKEEL: botany: the lower part of a papilionaceous flower (as of a pea or bean plant) that consists of two fused petals, lies between the wings, and encloses the pistil and stamensKNAR*: M-W: variant of knaur, a knot or burl on woodKNEE: a rounded or conical process rising from the roots of various swamp-growing trees (e.g., a cypress knee)KNOT: the base of a woody branch enclosed in the stem from which it arises (also: its section in lumber)KNOTHOLE: a hole in a board or tree trunk where a knot or branch has come outLABIA: plural of labium, the lower lip of a labiate corollaLABIAL: of, relating to, or situated near the lips or labia, the lower lip of a labiate corollaLAMINA: the expanded part of a foliage leaf as distinguished from the petioleLAMINAE: the expanded part of a foliage leaf as distinguished from the petioleLAMINAL: arranged in, consisting of, or resembling laminae; a lamina is the expanded part of a foliage leaf as distinguished from the petioleLATEX: a milky usually white fluid that is produced by cells of various seed plants (as of the milkweed, spurge, and poppy families) and is the source of rubber, gutta-percha, chicle, and balataLEAF: a lateral outgrowth from a plant stem that is typically a flattened expanded variably shaped greenish organ, constitutes a unit of the foliage, and functions primarily in food manufacture by photosynthesis; also; a modified leaf (such as a bract or sepal) primarily engaged in functions other than food manufacture; also, foliage (trees in full leaf); also, to shoot out or produce leaves (leaf out in spring)LEAFAGE*: foliage: the aggregate of leaves of one or more plantsLEAFED: a lateral outgrowth from a plant stem that is typically a flattened expanded variably shaped greenish organ, constitutes a unit of the foliage, and functions primarily in food manufacture by photosynthesis; also; a modified leaf (such as a bract or sepal) primarily engaged in functions other than food manufacture; also, foliage (trees in full leaf); also, to shoot out or produce leaves (leaf out in spring)LEAFING: a lateral outgrowth from a plant stem that is typically a flattened expanded variably shaped greenish organ, constitutes a unit of the foliage, and functions primarily in food manufacture by photosynthesis; also; a modified leaf (such as a bract or sepal) primarily engaged in functions other than food manufacture; also, foliage (trees in full leaf); also, to shoot out or produce leaves (leaf out in spring)LEAFLET: one of the divisions of a compound leaf; a small or young foliage leafLEAVE: to leaf: to shoot out or produce leaves (leaf out in spring)LEGGY: of a plant, having long shoots or stems with little foliage: spindlyLEMMA: the lower of the two bracts enclosing the flower in the spikelet of grassesLIMB: the expanded portion of an organ or structure, especially: the upper spreading portion of a corolla (as of the phlox) whose lower part consists of a tube of fused petals; also, a large primary branch of a tree; also, to cut off the limbs of (a felled tree)LIMB: a large primary branch of a tree; also, to cut off the limbs of (a felled tree)LINT: a fibrous coat of thick convoluted hairs borne by cotton seeds that yields the cotton stapleLITTLE: of a plant or animal: small in comparison with related forms —used in vernacular names (little bluestem)LOBAR*: of or relating to a lobe, a curved or rounded projection or division. specifically: a usually somewhat rounded projection or division of a bodily organ or partLOBE: a curved or rounded projection or division; specifically: a usually somewhat rounded projection or division of a bodily organ or partLOBED: having lobes, a curved or rounded projection or division; specifically: a usually somewhat rounded projection or division of a bodily organ or partMALE: of plants: having or producing only stamens or staminate flowers (a male holly); a plant having stamens but no pistilsMANNA: the sweetish dried exudate of a Eurasian ash (especially Fraxinus ornus) that contains mannitol and has been used as a laxative and demulcentMARK: to furnish with natural marks (a bird’s wings marked with white; leaves marked with spots)MIDRIB: the central vein of a leafMILK: the latex of a plant or the contents of an unripe kernel of grainNAKED: of a plant or one of its parts: lacking pubescence or enveloping or subtending parts (smooth, naked stems)NECK: the slender proximal end of a fruitNEEDLE: a needle-shaped leaf (as of a conifer)
NERVE: vein: any of the vascular bundles forming the framework of a leafNODAL: being, relating to, or located at or near a node: a point on a stem at which a leaf or leaves are insertedNODE: a point on a stem at which a leaf or leaves are insertedNODULE: a swelling on a leguminous root that contains symbiotic bacteriaNUTTY: having or producing nuts (nutty trees)OAKEN: made from the wood of an oak treeORGAN: a differentiated structure (such as a heart, kidney, leaf, or stem) consisting of cells and tissues and performing some specific function in an organism; also, bodily parts performing a function or cooperating in an activity (the eyes and related structures that make up the visual organs)OVARY: the enlarged rounded usually basal portion of the pistil or gynoecium of an angiospermous plant that bears the ovules and consists of one or more carpelsOVATE: of leaves: having an outline like a longitudinal section of an egg with the basal end broader (ovate leaves)OVULAR: of or relating to an ovule or ovum (a female gamete: macrogamete, called also egg cell)OVULE: a structure of a seed plant that gives rise to female reproductive cells and is found within the floral ovaries of angiosperms or are borne on female strobili of gymnospermsPART: one of the constituent elements of a plant or animal body: such as an organ or memberPETAL: one of the modified often brightly colored leaves of the corolla of a flowerPITH: a usually continuous central strand of spongy tissue in the stems of most vascular plants that probably functions chiefly in storage; also, any of various loose spongy plant tissues that resemble true pith; also, to remove the pith from (a plant stem)PITHY: consisting of or abounding in pithPLACENTA: a sporangium-bearing surface, especially: the part of the carpel bearing ovulesPLUME: a plumose appendage of a plantPOLE: a tree with a breast-high diameter of from 4 to 12 inches (10 to 30 centimeters)POLLEN: a mass of microspores in a seed plant appearing usually as a fine dustPOME: a fleshy fruit (such as an apple or pear) consisting of an outer thickened fleshy layer and a central core with usually five seeds enclosed in a capsulePRICKLY: full of or covered with prickles; especially: distinguished from related kinds by the presence of pricklesPULP: the soft, succulent part of a fruit usually composed of mesocarp; stem pith when soft and spongyQUILL: a roll of dried bark (cinnamon quills)RAMIFY: to send forth branches or extensions; to cause to branchRICIN: a poisonous protein in the castor bean, the very poisonous seed of the castor-oil plant, a tropical Old World herb (Ricinus communis) widely grown as an ornamental or for its oil-rich castor beansRING: the annual ring: the layer of wood produced by a single year's growth of a woody plantROOT: the usually underground part of a seed plant body that originates usually from the hypocotyl, functions as an organ of absorption, aeration, and food storage or as a means of anchorage and support, and differs from a stem especially in lacking nodes, buds, and leaves; also, any subterranean plant part (such as a true root or a bulb, tuber, rootstock, or other modified stem) especially when fleshy and edible; also, to furnish with or enable to develop roots; to fix or implant by or as if by roots; to grow roots or take rootTALL: of a higher growing variety or species of plantTAPROOT: a primary root that grows vertically downward and gives off small lateral rootsTEETH: a small sharp-pointed marginal lobe or process on a plantTENTACLE: a sensitive hair or emergence on a plant (such as the sundew)THORN: a sharp rigid process on a plant, especially: one that is a short, indurated, sharp-pointed, and leafless modified stemTHROAT: the orifice of a tubular organ especially of a plantTOOTH: a small sharp-pointed marginal lobe or process on a plantTOOTHED: having teeth especially of a specified kind or number —often used in combination (fine-toothed)TORI: plural of torus, the thickening of a membrane closing a wood-cell pit (as of gymnosperm tracheids) having the secondary cell wall arched over the pit cavityTORIC: of, relating to, or shaped like a torus or segment of a torus, the thickening of a membrane closing a wood-cell pit (as of gymnosperm tracheids) having the secondary cell wall arched over the pit cavityTRAIL: a trailing plant; a spray; also, to grow to such length as to droop over toward the ground (trailing branches of a weeping birchTUBE: a slender channel (such as a fallopian tube or a pollen tube) within a plant or animal body: a duct; also, the narrow basal portion of a corolla with united petals or a calyx with united sepalsTUFFET: a tuft, a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends, especially: a growing bunch of grasses or close-set plantsTUFT: a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends (a tuft of hair/feathers); especially: a growing bunch of grasses or close-set plants; also, to form into or grow in tuftsTUFTED: having a tuft or tufts, a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends (a tuft of hair/feathers); especially: a growing bunch of grasses or close-set plants; also, to form into or grow in tuftsTUNIC: the tunica, an enclosing or covering membrane or tissue (the tunic of a seed)TURN: [of foliage] to change color (the leaves have turned); to change the color of (foliage)TWIG: a small shoot or branch usually without its leavesVAGINAL: of or relating to a theca, an enveloping sheath or case of an animal or animal partVALVE: one of the segments or pieces into which a dehiscing capsule or legume separates; also, the portion of various anthers (as of the barberry) resembling a lidVEIN: any of the vascular bundles forming the framework of a leafVEINED: patterned with or as if with veins: having venation, an arrangement or system of veins (as in the tissue of a leaf or the wing of an insect): streaked VEINING: a pattern of veins: venation, an arrangement or system of veins (as in the tissue of a leaf or the wing of an insect) VINE: a plant whose stem requires support and which climbs by tendrils or twining or creeps along the ground; the stem of such a plant; also, to form or grow in the manner of a vineVINY: of, relating to, or resembling vines (viny plants); covered with or abounding in vinesWEBBED: [having or resembling a web,] a tissue or membrane of an animal or plantespecially: that uniting fingers or toes either at their bases (as in humans) or for a greater part of their length (as in many waterbirds)WHORL: an arrangement of similar anatomical parts (such as leaves) in a circle around a point on an axisWING: a foliaceous, membranous, or woody expansion of a plant especially along a stem or on a samara or capsule; also, either of the two lateral petals of a papilionaceous flower; also, having wings (winged seeds)WINGED: a foliaceous, membranous, or woody expansion of a plant especially along a stem or on a samara or capsule; also, either of the two lateral petals of a papilionaceous flower; also, having wings (winged seeds)WOOD: the hard fibrous substance consisting basically of xylem that makes up the greater part of the stems, branches, and roots of trees or shrubs beneath the bark and is found to a limited extent in herbaceous plantsWOODY: of or containing wood or wood fibers: ligneous (woody tissues); having woody parts: rich in xylem and associated structures (woody plants)WOOL: a dense felted pubescence (covered with fine soft short hairs), especially on a plant: tomentum, pubescence composed of densely matted woolly hairs
Trees and Shrubs
ACACIA: any of a large genus (Acacia) of leguminous shrubs and trees of warm regions with leaves pinnate or reduced to phyllodes and white or yellow flower clustersACAI: acai palm or less commonly açai palm: the palm (Euterpe oleracea) native to tropical rainforests of Central and South America that produces acai berriesACORN: the nut of the oak usually seated in or surrounded by a hard woody cupule of indurated bractsALMOND: a small tree (Prunus dulcis synonym P. amygdalus) of the rose family with flowers and young fruit resembling those of the peach, or its ellipsoidal edible kernel used as a nutANNATTO: a tropical American tree (Bixa orellana) from which annatto is derivedAPPLE: a usually cultivated tree (genus Malus) of the rose family, or its fruitAPRICOT: a temperate-zone tree (Prunus armeniaca) resembling the related peach and plum in flavorARABICA: an evergreen shrub or tree (Coffea arabica) yielding seeds that produce a high-quality coffee AZALEA: any of a subgenus (Azalea) of rhododendrons with funnel-shaped corollas and usually deciduous leaves including many species and hybrid forms cultivated as ornamentalBALM: a balsamic resin especially: one from small tropical evergreen trees (genus Commiphora of the family Burseraceae)BANYAN: a large fig tree (Ficus benghalensis) native to India and PakistanBAOBAB: a broad-trunked tropical tree (Adansonia digitata) of the silk-cotton family that is native to Africa and has an edible acidic fruit resembling a gourd and bark used in making paper, cloth, and ropeBEECH: any of a genus (Fagus of the family Fagaceae, the beech family) of hardwood trees with smooth gray bark and small edible nutsBRIAR: a plant (such as a rose, blackberry, or greenbrier) having a usually woody and thorny or prickly stem; a mass of briars; a twig or branch of a briarBRIARY: a plant (such as a rose, blackberry, or greenbrier) having a usually woody and thorny or prickly stem; a mass of briars; a twig or branch of a briarBROOM: any of various leguminous shrubs (especially genera Cytisus and Genista) with long slender branches, small leaves, and usually showy yellow flowers CACAO: a tree having small yellowish flowers followed by fleshy pods from which cacao is obtainedCAMELLIA: any of a genus (Camellia) of shrubs or trees of the tea family, esp. an ornamental greenhouse shrub (C. japonica) with glossy leaves and roselike flowers from New Latin Camellia, from Camellus (Georg Josef Kamel †1706 Moravian Jesuit missionary)CANDLE: a thin, upright new shoot forming from a terminal bud on a pine tree in the springCANOPIC: related to the canopy, the uppermost spreading branchy layer of a forestCANOPY: related to the canopy, the uppermost spreading branchy layer of a forestCAROB: a Mediterranean evergreen leguminous tree (Ceratonia siliqua) with racemose red flowersCATALPA: any of a genus (Catalpa) of North American and Asian trees of the bignonia family with pale showy flowers in terminal clustersCINNAMON: any of several tropical trees (genus Cinnamomum) yielding a culinary spice, oil, and flavoringCITRON: a small shrubby tree (Citrus medica) that produces citrons and is cultivated in tropical regionsCLOVE: a tropical tree (Syzygium aromaticum or Eugenia aromatica) of the myrtle family that is used as a spice and is the source of an oilCOCA: 1) any of several A. American shrubs (genus Erythroxylon) esp. E. coca, the primary source of cocaine 2) dried leaves of a coca (especially E.n coca) containing alkaloids including cocaineCOCOBOLO*: the hard, heavy heartwood of any of various tropical American trees of the genus Dalbergia (especially D. retusa) that is typically yellowish-orange to reddish-brown in colorCOCONUT: the coconut palm whose outer fibrous husk yields coir and whose nut contains thick edible meat and, in the fresh fruit, a clear liquidCOLA: less common variant of kola tree: an African tree (genus Cola, especially C. nitida and C. acuminata of the family Malvaceae) cultivated in various tropical areas for its kola nutsCOTTONWOOD: any of several poplars having seeds with cottony hairsCRAB: crab apple; any of various wild or cultivated trees (genus Malus) that are cultivars or relatives of the cultivated apple and that produce small sour fruitCURRANT: a small seedless raisin originally grown chiefly in the eastern Mediterranean, or the acid edible fruit of various shrubs …Back-formation from earlier corawnce, currantes, ellipsis from Middle English reysouns of corans, borrowed from Anglo-French raisins de Curance "raisins of Corinth," from Corinth, GreeceDAPHNE: any of a genus (Daphne) of Eurasian shrubs of the mezereon family with apetalous flowers whose colored calyx resembles a corolla. Leaves resemble laurel. Named for Daphne, a nymph in Greek mythology who is transformed into a laurel tree to escape the pursuing ApolloDATE: the tall palm with pinnate leaves that yields the dateDOGWOOD: any of various trees and shrubs (genus Cornus of the family Cornaceae, the dogwood family) with clusters of small flowers and often large white, pink, or red involucral bractsDURIAN: a southeast Asian tree (Durio zibethinus) of the mallow family that bears durian fruitEBON: a hard heavy blackish wood yielded by various tropical chiefly southeast Asian trees (genus Diospyros of the family Ebenaceae, the ebony family)EBONY: a hard heavy blackish wood yielded by various tropical chiefly southeast Asian trees (genus Diospyros of the family Ebenaceae, the ebony family)GINKGO: a gymnospermous dioecious tree (Ginkgo biloba) of eastern China that is widely grown as an ornamental or shade tree and has fan-shaped leaves and foul-smelling yellowish fleshy seed coatsGUAVA: any of several tropical American shrubs or small trees (genus Psidium) of the myrtle family, especially: a shrubby tree (P. guajava) widely cultivated for its yellow-skinned fruit with sweet acid yellow or pink fleshHARDTACK: any of several mountain mahoganies (especially Cercocarpus betuloides)HAWTHORN: any of a genus (Crataegus) of spring-flowering spiny shrubs or small trees of the rose family with glossy and often lobed leaves, white or pink fragrant flowers, and small red fruitsHEMLOCK: any of a genus (Tsuga) of evergreen coniferous trees of the pine familyHENNA: the Old World tropical shrub or small tree (Lawsonia inermis) of the loosestrife family that yields henna dye and has small opposite leaves and clusters of fragrant usually white flowersHICKORY: any of a genus (Carya) of North American hardwood trees of the walnut family that often have sweet edible nuts; also, the usually tough wood of a hickory, short for obsolete pokahickory, from Virginia Algonquian pawcohiccora food prepared from pounded nutsHOLLY: any of a genus (Ilex of the family Aquifoliaceae, the holly family) of trees and shrubs, especially: either of two (I. opaca of the eastern U.S. and I. aquifolium of Eurasia) with spiny-margined evergreen leaves and usually red berries often used for Christmas decorationsILEX*: the holm oak, a southern European evergreen oak (Quercus ilex), or any of a genus (Ilex of the family Aquifoliaceae, the holly family) of trees and shrubs
IRONWOOD: any of numerous trees and shrubs (such as a hornbeam or hop hornbeam) with exceptionally tough or hard wood; also, he wood of an ironwoodJOJOBA: a shrub or small tree (Simmondsia chinensis synonym S. californica) of the box family of southwestern North America with edible seeds that yield a valuable liquid wax used especially in cosmeticsKAPOK: or kapok tree: a massive tropical deciduous tree (Ceiba pentandra) of the silk-cotton family that has a trunk with short, sharp prickles, a buttressed base, and porous lightweight wood and that bears large seedpods containing numerous silky fibersKOLA: M-W has an entry for kola tree or less commonly cola tree: an African tree (genus Cola, especially C. nitida and C. acuminata of the family Malvaceae) cultivated in various tropical areas for its kola nutsLANTANA: any of a genus (Lantana) of tropical shrubs or perennial herbs of the vervain family with showy heads of small bright flowersLARCH: any of a genus (Larix) of northern hemisphere trees of the pine family with short fascicled deciduous leaves; also: the wood of a larchLEMON: a tree that bears lemonsLILAC: a widely cultivated European shrub (Syringa vulgaris) of the olive family that has cordate ovate leaves and large panicles of fragrant pinkish-purple or white flowers; also, a tree or shrub congeneric with the lilacLIME: a tree that bears limes: the widely cultivated spiny tropical Asian citrus tree (Citrus aurantifolia); also, a linden tree, especially linden, a commonly cultivated European tree (T. europaea synonym T. vulgaris) much used for ornamental planting
LINDEN: any of a genus (Tilia of the family Malvaceae, the mallow family) of deciduous trees of temperate regions that have cordate leaves and a winglike bract attached to the peduncle of the flower and fruit and that are often planted as ornamental and shade trees: such as a commonly cultivated European tree (T. europaea synonym T. vulgaris) much used for ornamental planting [also called lime]; also, a tree (T. americana) chiefly of the central and eastern U.S., called also basswoodLITCHI: variant spelling of lychee: a slow-growing tree that bears lychees and has glossy, leathery leaves and terminal clusters of tiny, apetalous, greenish-white to yellow flowersLOBLOLLY: loblolly pine: a pine (Pinus taeda) of the southeastern U.S. with flaky bark, long needles in groups of three, and cones having spine-tipped scales; also: its coarse-grained woodLONGAN: a pulpy fruit related to the lychee and produced by a southeast Asian evergreen tree (Euphoria longan synonym Dimocarpus longan) of the soapberry family; also, a tree that bears the longanLYCHEE: or litchi or less commonly lichee; a slow-growing tree that bears lychees and has glossy, leathery leaves and terminal clusters of tiny, apetalous, greenish-white to yellow flowersMACADAMIA: M-W’s entry is for macadamia nut, a hard-shelled nut of an Australian evergreen tree (genus Macadamia, especially M. integrifolia or M. tetraphylla) of the protea family that somewhat resembles the filbert and is cultivated extensively in Hawaii; called also macadamia; named for John Macadam †1865 Scottish-born Australian chemistMAHOGANY: a tree that yields mahogany; any of various chiefly tropical trees (family Meliaceae, the mahogany family): the durable yellowish-brown to reddish-brown usually moderately hard and heavy wood of a West Indian tree (Swietenia mahagoni) that is widely used for cabinetwork and fine finish work; also, a wood similar to mahogany from a congeneric tropical American tree (especially S. macrophylla); also, the rather hard heavy usually odorless wood of any of several African trees (genus Khaya); also, the rather lightweight cedar-scented wood of any of several African trees (genus Entandrophragma) that varies in color from pinkish to deep reddish brownMANDARIN: a small spiny orange tree (Citrus reticulata) of southeastern Asia with yellow to reddish-orange loose-rinded fruits; also, a tree (such as the satsuma) developed in cultivation from the mandarin by selective breeding or hybridization; also, the fruit of a mandarinMANGO: an evergreen tree (Mangifera indica) of the cashew family that bears mangoes
MANZANITA: any of various western North American evergreen shrubs (genus Arctostaphylos) of the heath family with alternate leavesMAPLE: any of a genus (Acer of the family Sapindaceae, the soapberry family) of chiefly deciduous trees or shrubs with opposite leaves and a fruit of two united samarasMATE: maté or mate: a South American shrub or tree (Ilex paraguariensis) of the holly family whose leaves and shoots are used in making maté; also: these leaves and shootsMOCHA: the small, irregular-shaped coffee beans of plants grown in the mountainous regions of Yemen that produce an earthy, strong coffee of usually medium to high acidity, named for Mocha, Yemen; also, a similar coffee grown in EthiopiaNUTMEG: a tree yielding nutmeg; an aromatic seed produced by an evergreen tree (Myristica fragrans of the family Myristicaceae, the nutmeg family) native to the Moluccas; also: the ground seed used as a spiceOLIVE: a Mediterranean evergreen tree (Olea europaea of the family Oleaceae, the olive family) cultivated for its drupaceous fruit that is an important food and source of oil; also: the fruit of the olive tree; also, any of various shrubs and trees resembling the olivePALM: any of a family (Palmae synonym Arecaceae) of mostly tropical or subtropical monocotyledonous trees, shrubs, or vines with usually a simple stem and a terminal crown of large pinnate or fan-shaped leavesPALMETTO: any of several usually low-growing fan-leaved palms, especially: cabbage palmetto; also, strips of the leaf blade of a palmetto used in weavingPALMY: abounding in or bearing palmsPALMYRA: a tall fan-leaved palm (Borassus flabellifer) of India cultivated for its hard resistant wood, fiber, and sugar-rich sap, called also palmyra palmPAPAW: or more commonly pawpaw, the papaya, a tropical American tree (Carica papaya of the family Caricaceae, the papaya family) having an oblong to globose yellow edible fruit with numerous black seeds in a central cavity; also: its fruit. Also, a North American tree (Asimina triloba) of the custard-apple family with purple flowers and an edible green-skinned fruit; also, its fruitPAPAYA: a tropical American tree (Carica papaya of the family Caricaceae, the papaya family) having an oblong to globose yellow edible fruit with numerous black seeds in a central cavity; also, its fruitPAWPAW: or less commonly papaw, the papaya, a tropical American tree (Carica papaya of the family Caricaceae, the papaya family) having an oblong to globose yellow edible fruit with numerous black seeds in a central cavity; also: its fruit. Also, a North American tree (Asimina triloba) of the custard-apple family with purple flowers and an edible green-skinned fruit; also, its fruitPEACH: a low spreading freely branching Chinese tree (Prunus persica) of the rose family that has lanceolate leaves and sessile usually pink flowers and is widely cultivated in temperate areas for its edible fruit which is a single-seeded drupe with a hard central stone, a pulpy white or yellow flesh, and a thin fuzzy skin; also, the edible fruit of the peachPECAN: a large hickory (Carya illinoinensis synonym C. oliviformis) that has roughish bark and hard but brittle wood and is widely grown in the warmer parts of the U.S. and in Mexico for its edible nut; also, the wood of the pecan treePEONY: any of a genus (Paeonia of the family Paeoniaceae) of chiefly Eurasian plants with large often double flowers; also, the flower of a peony; from Greek paiōnia, from Paiōn Paeon, physician of the godsPINE: any of a genus (Pinus of the family Pinaceae, the pine family) of coniferous evergreen trees that have slender elongated needles and include some valuable timber trees and ornamentals; also, any of various Australian coniferous trees (as of the genera Callitris or Araucaria)PINEY: of or related to any of a genus (Pinus of the family Pinaceae, the pine family) of coniferous evergreen trees that have slender elongated needles and include some valuable timber trees and ornamentals; also, any of various Australian coniferous trees (as of the genera Callitris or Araucaria)PLANE: any of a genus (Platanus of the family Platanaceae, the plane-tree family) of chiefly deciduous trees with large palmately lobed leaves, flowers in globose heads, and usually scaling bark; called also buttonwood, plane tree, sycamorePLUM: any of various trees and shrubs (genus Prunus) of the rose family with globular to oval smooth-skinned edible fruits that are drupes with oblong seeds; also, any of various trees with edible fruits resembling plums; also, their fruitPOINCIANA: any of several ornamental tropical trees or shrubs (genera Caesalpinia and Delonix) of the legume family formerly placed in their own genus (Poinciana); from De Poinci, 17th century governor of part of the French West IndiesPOMELO: a large widely cultivated tropical tree (Citrus maxima synonym C. grandis) of southeast Asia that bears pomelos, a very large thick-rinded usually pear-shaped citrus fruit differing from the closely related grapefruit especially in its loose rind and often coarse dry pulpPOMELO: a small citrus tree (Citrus paradisi) that produces grapefruit, a large round citrus fruit with a bitter yellow rind and a juicy somewhat tart pale yellow, pink, or reddish pulp; also, POPLAR: any of a genus (Populus) of slender catkin-bearing quick-growing deciduous trees (such as an aspen or cottonwood) of the willow family; also, the tulip tree, a tall North American timber tree (Liriodendron tulipifera) of the magnolia family having large greenish-yellow tulip-shaped flowers and soft white wood used especially for cabinetwork and woodenware; called also tulip poplar, yellow poplarthe wood of a poplarRAMBUTAN: a tree (Nephelium lappaceum) of the soapberry family that bears the rambutan, a bright red spiny Malayan fruit closely related to the lycheeRIND: the bark of a treeROOF: a canopy of leaves and branchesROWAN: The European mountain ash (a mountain ash (Sorbus aucuparia) of Eurasia that typically reaches a height of 20 to 40 feet (6.1 to 12.2 meters) and has showy clusters of small white flowers and bright orange to red berrylike fruits that are technically pomes) or the American mountain ash (a mountain ash (Sorbus americana) of the eastern U.S. and Canada that is typically 15 to 30 feet (4.6 to 9.1 meters) tall and has showy clusters of small white flowers and bright orange-red berrylike fruits that are technically pomes); also, the fruit of a European or American mountain ashTAMARIND: an African evergreen tree (Tamarindus indica) of the legume family that is widely grown in tropical regions and has hard yellowish wood, pinnate leaves, red-striped yellow flowers, and an edible fruitTEAK: a tall tropical Asian timber tree (Tectona grandis) of the mint family; also, the hard yellowish-brown wood of teak used especially for furniture and shipbuildingTHICKET: a dense growth of shrubbery or small trees: a copseTHORN: a woody plant bearing sharp impeding processes (such as prickles or spines), especially; the hawthornTOON: a southeast Asian and Australian tree (Toona ciliata synonym Cedrela toona) of the mahogany family with aromatic dark red to reddish-brown wood; also, its woodTORO: a New Zealand tree (Myrsine salicina) with reddish figured wood used for inlayingTUPELO: any of a genus (Nyssa of the family Nyssaceae) of North American and Asian deciduous trees that have simple alternate leaves, small usually greenish-white dioecious flowers, and a rounded drupe, especially: black gum; also, the pale soft wood of a tupeloWAHOO: an elm (Ulmus alata) of the U.S. having twigs with prominent corky projections; also, a shrubby spindle tree (Euonymus atropurpureus) of chiefly eastern North America that has purple capsules which in dehiscence expose scarlet-ariled seeds (called also burning bush)WATTLE: Australia: acacia, any of a large genus (Acacia) of leguminous shrubs and trees of warm regions with leaves pinnate or reduced to phyllodes and white or yellow flower clustersWILLOW: any of a genus (Salix of the family Salicaceae, the willow family) of trees and shrubs bearing catkins of apetalous flowers and including forms of value for wood, osiers, or tanbark and a few ornamentalsWILLOWY: abounding with willows
Words about Botanicals
BOTANIC: variant of botanical: of or relating to plants or botany; also, derived from plantsBOTANY: a branch of biology dealing with plant life; also, plant life; also, the properties and life phenomena exhibited by a plant, plant type, or plant group; also, a botanical treatise or study, especially: a particular system of botanyFLORA: a treatise on or list of the plants of an area or period; or plant, bacterial, or fungal life, especially: such life characteristic of a region, period, or special environment; from Latin Flōra, the goddess of flowers and the flowering seasonFLORAL: of or relating to a flora, a treatise on or list of the plants of an area or period; or plant, bacterial, or fungal life, especially: such life characteristic of a region, period, or special environment; from Latin Flōra, the goddess of flowers and the flowering seasonPLANT: any of a kingdom (Plantae) of multicellular eukaryotic mostly photosynthetic organisms typically lacking locomotive movement or obvious nervous or sensory organs and possessing cellulose cell wallsVEGETABLE: a plant, any of a kingdom (Plantae) of multicellular eukaryotic mostly photosynthetic organisms typically lacking locomotive movement or obvious nervous or sensory organs and possessing cellulose cell walls; also, of, relating to, constituting, or growing like plants; consisting of plants: vegetationalVEGETAL: (adj) vegetable: relating to, constituting, or growing like plants; consisting of plants: vegetationalVEGETATE: to grow in the manner of a plant; also: to grow exuberantly or with proliferation of fleshy or warty outgrowths; to produce vegetation; to establish vegetation in or onVEGETATED: to grow in the manner of a plant; also: to grow exuberantly or with proliferation of fleshy or warty outgrowths; to produce vegetation; to establish vegetation in or onWEED: a plant that is not valued where it is growing and is usually of vigorous growth, especially: one that tends to overgrow or choke out more desirable plants; also, a weedy growth of plantsWEEDY: abounding with or consisting of weeds; resembling a weed especially in vigorous growth or ready propagation
Spelling Bee words related to
BOTANICALS
ABLOOMACACIAACAIACORNAGARAGAVEALFALFAALGAALGAEALGALALLIUMALMONDALOEALPINEAMARANTHANEMONEANGELICAANNATTOANNUALANNULIAPPLEAPRICOTARABICAARBORARILARNICAARROWROOTARUGULAARUMAXIALAXIALLYAZALEABALMBAMBOOBANANABANYANBAOBABBARKBEANBEDDINGBEECHBEETBELLBENTBETEL
BIENNIALBLACKCAPBLEWBLIGHTBLINDBLOOMBLOOMEDBLOOMINGBLOWBLOWINGBLOWNBLUEBELLBLUEBOTTLEBODYBOLLBOLLS
BOOTBOTANICBOTANYBOUGHBOURBONBRANCHBRANCHYBRIARBRIARYBROOMBUDDEDBUDDINGBULBBURLBURRBUTTBUTTONCACAOCACTICALLACALLALOOCAMELLIACANDLECANECANNACANOLACANOPICCANOPYCARAWAYCAROBCARROTCATALPACATKINCATMINTCATNIPCATTAILCAYENNECHALICECHARDCHEATCHIACHICORYCHILICHLOROPHYLLCICELYCINNAMONCIRRICITRONCLEFTCLIMBCLOTBURCLOVECOBSCOCACOCKLECOCOBOLO*COCONUTCOFFEECOIRCOLACOLLARDCOLLECTIVECOMACOMPLETECOMPOUNDCONECONKCORKCORKYCORNCORNCOBCOROLLACORONACOTTONCOTTONWOODCRABCROCICROTCHCUBECUKECUMINCUPULE*CURLCURLYCURRANTCUTICLEDAHLIADAPHNEDATEDAYLILYDEADHEADDEADHEADEDDEADWOODDEFINITEDIATOMDILLDIVIDEDDOCKDOGWOODDRIFTDUCTDURIANDURUMEBONEBONYEDEMAEGGPLANTENDIVEETHYLENEFALLFALLSFANCILYFAVAFEMALEFENNELFLAGFLAGELLAFLATFLAVORFLAXFLOATFLORAFLORALFLORALLY
FORCINGFORMICFOXGLOVEFRONDFRUITFRUITFULFRUITIONFUNGALFUNGIGALANGALGALLGARBANZOGARLICGILLGINKGOGLADGLADIOLIGLANDGNARLGNARLYGOURDGRAFTGRAFTINGGRAINGRAMGRAMMAGUARGUAVAGUMMEDGUMMINGHAIRHAIRYHALOINGHANDHARDHARDTACKHARDYHAWTHORNHEADHEADEDHEATHHEDGEHEDGEDHEDGINGHEELHEMLOCKHEMP
HENBANEHENNAHEPATICHICKORYHILLHILLEDHILLINGHOARHOARYHOEDHOEINGHOLLYHONEYDEWHOODEDHULLHYACINTHILEX*INDICAINDIGOINNOCENCEIPECAC
IRONWOODIVIEDJOINTJOINTEDJOJOBAKALEKAPOKKEELKELPKNAR*KNEEKNOTKNOTHOLEKOLALABIALABIALLAMELLA*LAMELLAE*LAMINALAMINAELAMINALLANTANALARCHLATEX
LEAFLEAFAGE*LEAFEDLEAFINGLEAFLETLEAVELEEKLEGGYLEMMALEMONLENTILLETTUCELICHENLILACLILYLIMALIMBLIME
LINDENLINTLITCHILITTLELOBAR*LOBELOBEDLOBLOLLYLOCOLOCOWEEDLONGANLOOFALOOFAHLOOFASLOPPINGLOVAGELUPINELYCHEEMACADAMIAMAHOGANYMAIZEMALEMALLOWMANDARINMANGOMANNA
MANZANITAMAPLEMARIJUANAMARKMATEMEDICMIDRIBMIGNONETTEMILDEWMILDEWEDMILKMILLETMINTMOCHAMOLDMOLDEDMOLDINGMOLDYMOTTLEMULEMULTIPLYMUNGNAIADNAKEDNECKNEEDLE
NERVENETTLENETTLY*NICOTINENODALNODENODULENONDORMANT*NUBBINNUTMEGNUTTYOAKENOAKYOCOTILLO*OKRAOLIVEONIONORCHIDORGANOVARYOVATEOVULAROVULEPALMPALMETTOPALMYPALMYRAPAPAWPAPAYAPAPYRIPARTPAWPAWPEACHPEANUTPEATPEATYPECANPEONYPETALPEYOTEPINCHPINCHINGPINEPINEAPPLEPINEYPINKPINOTPITAPITHPITHYPLACENTAPLANEPLANTPLANTABLEPLANTAINPLOTPLOTTINGPLUMPLUMEPOINCIANAPOKEPOLEPOLLPOLLARD*POLLENPOLLINGPOMEPOMELOPOPLARPOPPYPOTATOPRICKPRICKLYPROPAGATORPRUNINGPUDDLEPUDDLEDPULLPULLEDPULPPUMPKINQUADRATQUILLRADICALRAGWORTRAMBUTANRAMIFYRAMPRANKRANKLYRAPINIRATTANRICINRINDRINGRINGINGROOFROOTROWANTAKETAKENTALLTAMARINDTAMETAMEDTAMELYTAMINGTANGLETAPIOCATAPROOTTAROTARRAGONTEAKTEETHTEFFTENDTENDEDTENTACLETHATCHTHICKETTHORNTHRIFTTHROATTHYMETOBACCOTOMATILLOTOMATOTOOKTOONTOOTHTOOTHEDTOPIARYTOPPEDTOPPINGTORITORICTOROTRAILTRAINTUBETUFFETTUFTTUFTEDTULIPTUNATUNICTUPELOTURFTURNTWIGTWITCHUNFRUITFULUNWEEDEDUPROOTVAGINALVALVEVANILLAVEGETABLEVEGETALVEGETALVEGETATEVEGETATEDVEINVEINEDVEININGVIGORVINEVINYVIOLAVIOLETWAHOOWANTONWARTWARTYWATTLEWEBBEDWEEDWEEDEDWEEDINGWEEDYWHEATWHORLWILDLINGWILLOWWILLOWYWILTWINGWINGEDWOODWOODYWOOLWORTWOUNDWRACKYARDWORKYARROWYUCAYUCCAZINNIA