LexiTopic: Intoxicants
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to INTOXICANTS in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right; the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to INTOXICANTS
SUBJECT HEADINGS IN THIS LEXITOPIC:
Alcoholic Beverages: TypesAlcoholic Beverages: Words About including sources, brewing, manufacture, bottling, portions, etc.Drugs not medicationsTobacco and Smoking not marijuanaUse, Behavior, and Addiction
NOTES ABOUT THE TAXONOMY FOR INTOXICANTS
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to alcoholic beverages and certain drugs used recreationally by humans.
Words related to drinking places and the people employed there are in ENTERTAINMENT, HOSPITALITY, AND SERVICE.
Words related to nonalcoholic beverages are in FOOD AND DRINK.
Words related to medicinal drugs are in HUMAN HEALTH AND MEDICINE.
Words related to mental health and illness in general are in HUMAN HEALTH AND MEDICINE.
Topical arrangement of Spelling Bee words related to INTOXICANTS
Alcoholic Beverages
ALCOPOP: a flavored beverage containing usually 4 to 6 percent alcoholAPPLEJACK: brandy distilled from hard cider; also: an alcoholic beverage traditionally made by freezing hard cider and siphoning off the concentrated liquorBOCK: a dark lager beer with a high alcohol content that has a strong flavor of malt and a mild flavor of hops and is typically sold in the winter or early springBOCKS: a dark lager beer with a high alcohol content that has a strong flavor of malt and a mild flavor of hops and is typically sold in the winter or early springBOND: alcohol: a 100-proof straight whiskey aged at least four years under government supervision before being bottled; called also bonded whiskeyBOOZE: intoxicating drink, especially: hard liquor; also, to drink intoxicating liquor especially to excessBOTTLE: [used figuratively,] intoxicating drink: the practice of drinking (slipped deeper and deeper into the bottle)BOURBON: a whiskey distilled from a mash made up of not less than 51 percent corn plus malt and rye; probably named after Bourbon County, Kentucky, or its pre-statehood predecessor, a county of Virginia that included much of northeastern KentuckyBRANDY: an alcoholic beverage distilled from wine or fermented fruit juiceBRUT: of champagne: very dry; or a very dry champagne or sparkling wineBUBBLY: a sparkling wine, especially ChampagneCANARY: a Canary Islands usually sweet wine similar to Madeira; Middle French canarie, from Old Spanish canario, from Islas Canarias Canary IslandsCAVA: a sparkling wine produced in CataloniaCHARD: Short for chardonnay (sometimes capitalized), a dry white table wine typically made from a single white grape variety originally grown in France; believed to be named after the village of Chardonnay in the Mâconnais region of FranceCHIANTI: M-W and NOAD both capitalize this dry usually red wine named for the Tuscany region of Italy where it is producedCHICA: variant of chicha, a South American and Central American beer made chiefly from fermented maizeCOCKTAIL: a usually iced drink of wine or distilled liquor mixed with flavoring ingredients; also, of, relating to, or set aside for cocktails (a cocktail hour)COGNAC: a brandy from the departments of Charente and Charente-Maritime distilled from white wine; French, from Cognac, FranceCORDIAL: a liqueurCORN: corn whiskeyCURACAO: a liqueur flavored with the dried peel of the sour orange; Dutch curaçao, from Curaçao, Netherlands AntillesEGGNOG: a drink consisting of eggs beaten with sugar, milk or cream, and often alcoholic liquorFLIP: a mixed drink usually consisting of a sweetened spiced liquor with beaten eggsFORTY: or 40 US, informal: a forty-ounce bottle or other container of an alcoholic beverage (such as beer or malt liquor)GIMLET: a drink consisting of sweetened lime juice and gin or vodka and sometimes carbonated or plain waterGRAPPA: a dry colorless brandy distilled from fermented grape pomaceGROG: alcoholic liquor, especially: liquor (such as rum) cut with water and now often served hot with lemon juice and sugar sometimes added, named for Old Grog, nickname of Edward Vernon †1757 English admiral responsible for diluting the sailors' rumHOCK: often capitalized, chiefly British: Rhine wine, a usually white wine produced in the Rhine valley; modification of German Hochheimer, from Hochheim, GermanyHOOCH: slang: alcoholic liquor especially when inferior or illicitly made or obtained; short for hoochinoo, a distilled liquor made by the Hoochinoo (Hutsnuwu) Indians, a Tlingit tribeJACK: applejack or brandyLONGNECK: beer served in a bottle that has a long neckMALT: malt liquor, a fermented liquor made with malt, specifically: a strong, dry beer and especially a lager with a high alcohol content usually in excess of 5 percent and as much as 11 or 12 percent that is produced by adding ingredients (such as corn, rice, or dextrose) to malted barley to increase the level of fermentable sugar present in the wortMANHATTAN: Manhattan, or less commonly manhattan: a cocktail consisting typically of whiskey, vermouth, and bitters; named for Manhattan, borough of New York CityMARGARITA: a cocktail consisting of tequila, lime or lemon juice, and an orange-flavored liqueur, from the Spanish feminine name MargaritaMARTINI: a cocktail made of gin and dry vermouth, probably alteration of Martinez (cocktail), from the name MartinezMEAD: a fermented beverage made of water and honey, malt, and yeastMIRIN: a sweet Japanese cooking wine made from fermented riceMULE: less commonly Mule: Moscow mule, a cocktail made of vodka, ginger beer, and lime juice and usually served in a copper mugOUZO: a colorless anise-flavored unsweetened Greek liqueurPINOT: a wine made from pinot grapes, especially: pinot noirPORT: a sweet fortified wine of rich taste and aroma made in Portugal; also: a similar wine made elsewhere; from Oporto, PortugalPOTATION* : a usually alcoholic drink or brewRIOJA: a wine from the Rioja region of Spain, especially: a dry red wine from this regionROTGUT: cheap or inferior liquorRUMMY: of, involving, or containing rum
SAKE: or saki: a Japanese alcoholic beverage of fermented rice often served hotSAKES: or saki: a Japanese alcoholic beverage of fermented rice often served hotTODDY: a usually hot drink consisting of liquor (such as rum), water, sugar, and spicesWHITE: white wineWINE: the alcoholic fermented juice of fresh grapes used as a beverage; also, the alcoholic usually fermented juice of a plant product (such as a fruit) used as a beverage (blackberry wine) ; also, to drink wine; to give wine to (wined and dined his friends)WINED: the alcoholic fermented juice of fresh grapes used as a beverage; also, the alcoholic usually fermented juice of a plant product (such as a fruit) used as a beverage (blackberry wine) ; also, to drink wine; to give wine to (wined and dined his friends)WINING: the alcoholic fermented juice of fresh grapes used as a beverage; also, the alcoholic usually fermented juice of a plant product (such as a fruit) used as a beverage (blackberry wine) ; also, to drink wine; to give wine to (wined and dined his friends)WINY: having the taste or qualities of wine (a winey sauce)ZOMBIE: a mixed drink made of several kinds of rum, liqueur, and fruit juice
Alcoholic Beverages: Words About including sources, brewing, manufacture, bottling, portions, etc.
ALCOHOL: ethanol especially when considered as the intoxicating agent in fermented and distilled liquors; beverages containing alcoholALCOHOLIC: of, relating to, or caused by alcohol (an alcoholic odor); containing alcohol (an alcoholic beverage)AROMA: the odor of a wine imparted by the grapes from which it is made (e.g., the wine has a fruity aroma)BEADY: of liquor: marked by bubbles or beadsBUTT: a large cask especially for wine, beer, or waterCORKY: having an unpleasant odor and taste (as from a tainted cork) (corky wine)DRAFT: the act of drawing (as from a cask or keg); also, a portion of liquid so drawn (a draft of ale); also (adj.) being or having been ready to be drawn from a receptacle: being or having been on draft (drinking draft beer); also, draft beer (a glass of draft)DROP: a small quantity of drink (hasn't touched a drop of alcohol in three years)
ETHANOL: a colorless volatile flammable liquid C2H5OH that is the intoxicating agent in liquors and is also used as a solvent and in fuelFILM: a thin skin or membranous covering: a pellicle: a slimy or gelatinous film that contains bacteria, yeasts, or both and that may form on the surface of a liquid (such as beer, wine, or kombucha) during the process of fermentationFLIGHT: a selection of alcoholic drinks (such as wines, beers, or whiskeys) for tasting as a groupFORTIFY: to add distilled grape spirits to (wine) during fermentation to increase the alcohol contentFRUIT: the flavor or aroma of fresh fruit in mature wineGROUT: synonym for lees or dregs: the sediment of a liquor (such as wine) during fermentation and agingHARD: of beverages: containing alcohol; also, of wine or beer: having a bitter or acidic tasteHEAD: the foam or scum that rises on a fermenting or effervescing liquid (such as beer)HEELTAP: a small quantity of alcoholic beverage remaining (as in a glass after drinking)HOPPED: flavored with hops, the ripe dried female cone-like flower clusters of a north-temperate zone twining plant (Humulus lupulus) of the hemp family used especially to impart a bitter flavor to beerHOPPY: having the taste or aroma of hops —used especially of ale or beerINTOXICANT: something that intoxicates, especially: an alcoholic drinkLACE: to add a dash of liquor toLACED: to add a dash of liquor toLACING: to add a dash of liquor toLETHAL: having a high alcohol content (a lethal rum punch)LETHALLY: having a high alcohol content (a lethal rum punch)MAGNUM: a large wine bottle holding about 1.5 litersMALT: grain (such as barley) softened by steeping in water, allowed to germinate, and used especially in brewing and distilling; also, to convert [grain, such as barley] into malt; to make grain into malt; to become malt; to make or treat with malt or malt extract; to become malt; to make grain into maltMALTY: containing or resembling or tasting of malt: grain (such as barley) softened by steeping in water, allowed to germinate, and used especially in brewing and distillingMELLOW: of a wine: well aged and pleasingly mildMIXOLOGY: the art or skill of preparing mixed drinksMULL: to heat, sweeten, and flavor (a beverage, such as wine or cider) with spicesMULLED: to heat, sweeten, and flavor (a beverage, such as wine or cider) with spicesMULLING: to heat, sweeten, and flavor (a beverage, such as wine or cider) with spicesNEAT: without admixture or dilution: straight (neat brandy, neat cement)OAKY: of wine: having the characteristics of being aged in oak casks (an oaky chardonnay)OENOLOGY: less common spelling of enology, a science that deals with wine and wine makingOENOPHILE: a lover or connoisseur of winePELLICLE: a slimy or gelatinous film that contains bacteria, yeasts, or both and that may form on the surface of a liquid (such as beer, wine, or kombucha) during the process of fermentationPOTABLE: suitable for drinking; also, a liquid that is suitable for drinking, especially: an alcoholic beveragePOTION: a mixture of liquids (such as liquor or medicine)PROOF: the minimum alcoholic strength of proof spirit; also, strength with reference to the standard for proof spirit, specifically: alcoholic strength indicated by a number that is twice the percent by volume of alcohol present (whiskey of 90 proof is 45 percent alcohol); also, of standard strength or quality or alcoholic contentRACK: to draw off (wine) from the leesRAWLY: raw: not diluted or blended (raw spirits)ROUND: a drink [of liquor] apiece served at one time to each person in a group (I'll buy the next round.)TANNIC: of wine: containing an abundance of tannins: markedly astringentTANNIN: any of various soluble astringent complex phenolic substances of plant origin used especially in tanning leather and dyeing textiles, manufacturing ink, clarifying wine and beer, and in medicine; also, a substance that has a tanning effectTARTAR: a substance consisting essentially of cream of tartar that is derived from the juice of grapes and deposited in wine casks together with yeast and other suspended matters as a pale or dark reddish crust or sedimentespecially: a recrystallized product yielding cream of tartar on further purificationTIPPLE: a drink or a portion of a drink, especially one that is alcoholic; also, to drink liquor especially by habit or to excess; or to drink (liquor) especially continuously in small amountsTIPPLING: a drink or a portion of a drink, especially one that is alcoholic; also, to drink liquor especially by habit or to excess; or to drink (liquor) especially continuously in small amountsTOOTHFUL*: a small bite or mouthful, especially: a small drink of liquorVIRGIN: containing no alcohol (a virgin daiquiri)WHET: a drink of liquorWORK: to ferment, to undergo fermentation, the enzyme-catalyzed anaerobic breakdown of an energy-rich compound (such as a carbohydrate to carbon dioxide and alcohol or to an organic acid) by the action of microorganisms (such as bacteria or yeast) that occurs naturally and is commonly used in the production of various products (such as food, alcoholic beverages, and pharmaceuticals) especially by controlling microbial enzymatic activityWORKING: to ferment, to undergo fermentation, the enzyme-catalyzed anaerobic breakdown of an energy-rich compound (such as a carbohydrate to carbon dioxide and alcohol or to an organic acid) by the action of microorganisms (such as bacteria or yeast) that occurs naturally and is commonly used in the production of various products (such as food, alcoholic beverages, and pharmaceuticals) especially by controlling microbial enzymatic activityWORT: a sweet liquid drained from mash and fermented to make beer and whiskey
Drugs not medications
ACID: LSD, a semisynthetic illicit organic compound C20H25N3O derived from ergot that induces extreme sensory distortions, altered perceptions of reality, and intense emotional states, that may also produce delusions or paranoia, and that may sometimes cause panic reactions in response to the effects experienced, called also lysergic acid diethylamideBETEL: a climbing pepper (Piper betle) of southeastern Asia whose leaves are chewed together with betel nut and mineral lime as a stimulant masticatoryBLOW: slang: cocaineBLUNT: a cigar that has been hollowed out and filled with marijuana, or a marijuana cigaretteBONG: a simple water pipe consisting of a bottle or vertical tube partially filled with a liquid (such as water or liqueur) and a smaller offset tube ending in a bowlBUMP: slang: a small quantity of an illicit drug when inhaled in powdered form at one timeCAFFEINE: a bitter alkaloid C8H10N4O2 found especially in coffee, tea, cacao, and kola nuts and used medicinally as a stimulant and diureticCANNA: adj.: containing or infused with cannabisCOCA: dried leaves of a coca (especially Erythroxylon coca) containing alkaloids including cocaineCOKE: cocaineCRACK: crack cocaine: a potent form of cocaine that is obtained by treating the hydrochloride of cocaine with sodium bicarbonate to create small chips used illicitly for smokingDECK: a packet of narcoticsDIME: slang: a packet containing 10 dollars worth of an illicit drug (such as marijuana); called also dime bagDOOBIE: slang: a marijuana cigaretteDOPE: informal: an illicit drug (such as heroin or cocaine) used for its intoxicating or euphoric effects especially: marijuana; or to take such a drug; or to give a narcotic or intoxicating drug to, or to surreptitiously put a sedating drug intoDOPED: informal: an illicit drug (such as heroin or cocaine) used for its intoxicating or euphoric effects especially: marijuana; or to take such a drug; or to give a narcotic or intoxicating drug to, or to surreptitiously put a sedating drug intoDOPING: informal: an illicit drug (such as heroin or cocaine) used for its intoxicating or euphoric effects especially: marijuana; or to take such a drug; or to give a narcotic or intoxicating drug to, or to surreptitiously put a sedating drug intoDROP: to take (a drug) orally: to swallow (drop acid)DROPPING: to take (a drug) orally: to swallow (drop acid)DRUG: something and often an illegal substance that causes addiction, habituation or a marked change in consciousness; also, to affect (a person or animal) with a drug, especially: to stupefy (someone) by an intoxicating drug; to lull or stupefy (someone) as if with a drug (as if drugged by calming music); to add an illicit or intoxicating drug to (food or drink) usually surreptitiously; to take drugs especially for the intoxicating effectDRUGGING: to affect (a person or animal) with a drug, especially: to stupefy (someone) by an intoxicating drug; to lull or stupefy (someone) as if with a drug (as if drugged by calming music); to add an illicit or intoxicating drug to (food or drink) usually surreptitiously; to take drugs especially for the intoxicating effectFLAKE: slang: cocaineGANJA: a potent and selected preparation of marijuana used especially for smoking; broadly: marijuanaHEMLOCK: a drug or lethal drink prepared from the poison hemlockHEMP: marijuana or hashishHUFF: to inhale (noxious fumes) through the mouth for the euphoric effect produced by the inhalantHUFFED: to inhale (noxious fumes) through the mouth for the euphoric effect produced by the inhalantJOINT: a marijuana cigaretteLACE: to adulterate with a substance (laced a guard's coffee with a sedative)LACED: to adulterate with a substance (laced a guard's coffee with a sedative)LACING: to adulterate with a substance (laced a guard's coffee with a sedative)LINE: an amount of cocaine that is arranged in a line to be inhaled through the noseLOAD: to alter (something, such as an alcoholic drink) by adding an adulterant or drugLOADED: to alter (something, such as an alcoholic drink) by adding an adulterant or drugLOADING: to alter (something, such as an alcoholic drink) by adding an adulterant or drugMAINLINE: (slang) to take by or as if by injecting into a principal vein; to mainline a narcotic drugMARIJUANA: the psychoactive dried resinous flower buds and leaves of the female hemp or cannabis plant (Cannabis sativa or C. indica) that contain high levels of THC and are smoked, vaped, or ingested (as in baked goods) especially for their intoxicating effect: cannabisMETH: methamphetamine, a synthetic or semisynthetic compound C10H15N that stimulates the central nervous system, is used medically in the form of its crystalline hydrochloride C10H15N·HCl especially to treat attention deficit hyperactivity disorder and obesity, and that is often abused illicitly for its stimulant propertiesNICKEL: or less commonly nickle: slang: a packet containing five dollars worth of an illicit drug (such as marijuana); called also nickel bagOPIOID: any of various opiates (such as morphine), semisynthetic opiate derivatives (such as heroin, hydrocodone, or oxycodone), or synthetic preparations (such as fentanyl or methadone) that may be used illicitly for their narcotic properties and are associated with physiological tolerance, physical and psychological dependence, or addiction upon repeated or prolonged usePEYOTE: a hallucinogenic drug containing mescaline that is derived from the dried disk-shaped tops of the peyote cactus and is used especially in the religious ceremonies of some Indigenous American peoplesPOPPED: to take (pills) especially frequently or habituallyPOPPING: to take (pills) especially frequently or habituallyQUAALUDE: a tablet or capsule of methaqualone, a sedative and hypnotic nonbarbiturate drug C16H14N2O that is habit-forming, from Quaalude, a trademarkROACH: the butt of a marijuana cigaretteROCK: a small crystallized mass of crack cocaine, a potent form of cocaine that is obtained by treating the hydrochloride of cocaine with sodium bicarbonate to create small chips used illicitly for smokingTOKE: informal: a puff on a marijuana cigarette or pipeTOKING: informal: a puff on a marijuana cigarette or pipeTRANQ: Not in M-W; Collins has tranq, in British English a shortened form of tranquillizer; also, the street name of the [veterinary] sedative drug xylazine; also, to sedate (an animal), esp by shooting it with a tranquillizer dartWEED: marijuana
Tobacco and Smoking not marijuana
BRIAR: a tobacco pipe made from a woody root outgrowth of a shrub-like Mediterranean heath (Erica arborea)CHAW: a chew especially of tobaccoCHEW: to chew tobacco; also, a chew of tobaccoCHEWED: to chew tobaccoCHEWING: to chew tobaccoCIGAR: a small roll of tobacco leaf for smokingCORONA: a long cigar having the sides straight to the end to be lit and being roundly blunt at the other endDIPPED: to take a portion of (snuff); to place a pinch of (tobacco) between the lip or cheek and gum; to use dipping tobacco: to place a pinch of tobacco between the lip or cheek and gumDIPPING: to take a portion of (snuff); to place a pinch of (tobacco) between the lip or cheek and gum; to use dipping tobacco: to place a pinch of tobacco between the lip or cheek and gumDRAFT: the act or an instance of drinking or inhaling (a last draft on her cigarette); also, the portion drunk or inhaled in one such actDRAG: a draw on a pipe, cigarette, or cigar (took a drag on his cigar); also, to draw on, to inhale (drag on a cigarette)DRAGGING: a draw on a pipe, cigarette, or cigar (took a drag on his cigar); also, to draw on, to inhale (drag on a cigarette)HAND: a bunch of large leaves (as of tobacco) tied together usually with another leafHOOKAH: a water pipe, a smoking device that consists of a bowl mounted on a vessel of water which is provided with a long tube and arranged so that smoke is drawn through the water where it is cooled and up the tube to the mouthNICOTINE: a poisonous alkaloid C10H14N2 that is the chief active principle of tobacco and is used as an insecticidePANATELA: a long slender straight-sided cigarPIPE: a device for smoking usually consisting of a tube having a bowl at one end and a mouthpiece at the otherPLUG: a flat compressed cake of tobaccoPUFF: a perceptible cloud or aura emitted in a puff (a puff of smoke); also, to emit small whiffs or clouds (as of smoke) often as an accompaniment to vigorous action (puff at a pipe); to draw on (a cigar, cigarette, pipe, etc.) with intermittent exhalations of smokePUFFED: a perceptible cloud or aura emitted in a puff (a puff of smoke); also, to emit small whiffs or clouds (as of smoke) often as an accompaniment to vigorous action (puff at a pipe); to draw on (a cigar, cigarette, pipe, etc.) with intermittent exhalations of smokePULL: an inhalation of smoke; also, to draw hard in smoking (pulled at a pipe)QUID: a cut or wad of something chewableROLL: a cylindrical twist of tobaccoTOBACCO: the leaves of cultivated tobacco prepared for use in smoking or chewing or as snuff; also, manufactured products of tobacco (such as cigars or cigarettes); also: smoking as a practice (has sworn off tobacco)VAPE: to inhale vapor through the mouth from a usually battery-operated electronic device (such as an electronic cigarette) that heats up and vaporizes a liquid or solid; short for vaporWEED: tobacco productsWHIFF: to smoke, to inhale and exhale the smoke of (smoke a cigarette)
Use, Behavior, and Addiction
ACIDHEAD*: an individual who uses LSDADDICT: one exhibiting a compulsive, chronic, physiological or psychological need for a habit-forming substance, behavior, or activity; also, to cause addiction in (someone)ADDICTED: having an addiction: exhibiting a compulsive, chronic, physiological or psychological need for a habit-forming substance, behavior, or activity; also, to cause addiction in (someone)ADDICTING: causing addiction: addictive; also, causing a compulsive, chronic, physiological or psychological need for a habit-forming substance, behavior, or activity; also, to cause addiction in (someone)ADDICTION: a compulsive, chronic, physiological or psychological need for a habit-forming substance, behavior, or activity having harmful physical, psychological, or social effects and typically causing well-defined symptoms (such as anxiety, irritability, tremors, or nausea) upon withdrawal or abstinence: the state of being addictedADDICTIVE: causing or characterized by addictionALCOHOLIC: affected with alcoholism; also, a person affected with alcoholismBACCHANAL: drunken revelry or excessive indulgence; also, a devotee of Bacchus; also, of, relating to, or suggestive of the Bacchanalia; named for Bacchus, the Greek god of wineBACCHANALIA: drunken revelry or excessive indulgence; also, a devotee of Bacchus; also, of, relating to, or suggestive of the Bacchanalia; named for Bacchus, the Greek god of wineBACCHANALIAN: related to, or suggestive of, drunken revelry or excessive indulgence; also, a devotee of Bacchus; also, of, relating to, or suggestive of the Bacchanalia; named for Bacchus, the Greek god of wineBACCHIC: of, relating to, or suggestive of Bacchus or the Bacchanalia: bacchanalian; named for Bacchus, the Greek god of wineBAKED: slang: under the influence of a drug and especially marijuanaBEFUDDLE: to muddle or stupefy with or as if with drinkBEFUDDLED: to muddle or stupefy with or as if with drinkBENT: chiefly us slang: intoxicated, drunkBLIND: intoxicated; blind drunkBLOTTO: slang: drunkBOOZING: intoxicating drink, especially: hard liquor; also, to drink intoxicating liquor especially to excessBURNOUT: a person showing the effects of drug abuseCANDYMAN: M-W does not list this either as a closed compound or open compound or a hyphenated word. A drug dealer.CLEAN: free from drug addiction (has been clean for six months)DABBED: dab, verb: to inhale the vapors of a heated concentrate of cannabis (slang)DABBING: dab, verb: to inhale the vapors of a heated concentrate of cannabis (slang)DEPENDENCE: drug addiction; also, habituation: psychological dependence on a drug after a period of useDEPENDENT: affected with a drug dependenceDETOX: short for detoxified, to free (someone, such as a drug user or an alcoholic) from an intoxicating or an addictive substance in the body or from dependence on or addiction to such a substance; also, to remove a harmful substance (such as a poison or toxin) or the effect of such fromDETOXED: short for detoxified, to free (someone, such as a drug user or an alcoholic) from an intoxicating or an addictive substance in the body or from dependence on or addiction to such a substance; also, to remove a harmful substance (such as a poison or toxin) or the effect of such fromDETOXIFIED: to free (someone, such as a drug user or an alcoholic) from an intoxicating or an addictive substance in the body or from dependence on or addiction to such a substanceDOPEY: M-W: or less commonly dopy: dulled by alcohol or a narcoticDOPY: M-W: or more commonly dopey: dulled by alcohol or a narcoticDRANK: past tense and past participle of drink: to partake of alcoholic beverages; to bring to a specified state by drinking alcoholic beverages (drank himself into oblivion); to make or join in a toast (I'll drink your good healthDRUGGY: less common spelling of druggie: a person who habitually uses drugsFUDDLE: to make drunk: intoxicateFUDDLED: to make drunk: intoxicateGAVE: to propose as a toast (I give you Mr Harding)GIVE: to propose as a toast (I give you Mr Harding)GIVEN: to propose as a toast (I give you Mr Harding)GIVING: to propose as a toast (I give you Mr Harding)GUZZLING: to drink especially liquor greedily, continually, or habituallyHABIT: addiction (a drug habit)HEADY: tending to intoxicate or make giddy or elated (e.g., a heady wine)HIGH: intoxicated by or as if by a drug or alcoholIMBIBE: to drink alcoholic beveragesIMBIBED: to drink alcoholic beveragesIMBIBING: to drink alcoholic beveragesINTOXICANT: something that intoxicates, to excite or stupefy by alcohol or a drug especially to the point where physical and mental control is markedly diminishedINTOXICATION: the condition of having physical or mental control markedly diminished by the effects of alcohol or drugs (drank to the point of intoxication, cocaine intoxication)KICK: to free oneself of (something, such as a drug habit)KICKED: to free oneself of (something, such as a drug habit)KICKING: to free oneself of (something, such as a drug habit)LIGHTWEIGHT: a person who becomes inebriated after consuming relatively small amounts of alcohol or drugsLOAD: slang: an intoxicating amount of liquor drunkLOADED: chiefly US slang: intoxicated by alcohol or drugs, especially: drunkMALTY: addicted to malt liquorMUDDLE: to befog or stupefy, especially with liquorMUDDLED: to befog or stupefy, especially with liquorMULE: slang: a person who smuggles or delivers illicit substances (such as drugs)NAIVE: M-W has or naïve: not having previously used a particular drug (such as marijuana)
NARCO: US slang: one who traffics or deals drugs illegally; also: narcotic drugs —usually used before another noun (narco traffic/traffickers, narco smuggling; borrowed from American Spanish, probably short for narcotraficante "drug trafficker.”NIPPED: to take liquor in nips: to tippleNIPPING: to take liquor in nips: to tippleORGY: drunken revelryPOTATION* : a usually alcoholic drink or brew; also, the act or an instance of drinking or inhaling; as: the portion taken in one such actPOTHEAD: a person who frequently smokes marijuanaRUMMY: a drunkard; also, affected by or as if by an excessive intake of rumTEETOTAL: of, relating to, or practicing teetotalism, the principle or practice of complete abstinence from alcoholic drinksTIGHT: somewhat drunkTIPPLE: a drink or a portion of a drink, especially one that is alcoholic; also, to drink liquor especially by habit or to excess; or to drink (liquor) especially continuously in small amountsTIPPLING: a drink or a portion of a drink, especially one that is alcoholic; also, to drink liquor especially by habit or to excess; or to drink (liquor) especially continuously in small amountsTOOT: a drinking bout: a spree; also, slang: to take in (a drug, such as cocaine) by inhalation: to snortTOOTED: a drinking bout: a spree; also, slang: to take in (a drug, such as cocaine) by inhalation: to snortTOOTING: a drinking bout: a spree; also, slang: to take in (a drug, such as cocaine) by inhalation: to snortTOPE: to drink liquor to excess TOPED: to drink liquor to excess TOPING: to drink liquor to excess TOUCH: to take into the hands or mouth; [to ingest] (never touches alcohol)TOUCHED: to take into the hands or mouth; [to ingest] (never touches alcohol)TRIP: an intense visionary experience undergone by a person who has taken a psychedelic drug (such as LSD); also, to get high on a psychedelic drug (such as LSD): to turn on —often used with out; also, slang: to freak, to behave irrationally or unconventionally under the influence of drugsTRIPPY: of, relating to, or suggestive of a trip on psychedelic drugs or the culture associated with such drugsWEAN: to detach from a source of dependence (being weaned off the medication); also: to free from a usually unwholesome habit or interest (wean him off his drug use)WEANED: to detach from a source of dependence (being weaned off the medication); also: to free from a usually unwholesome habit or interest (wean him off his drug use)WEANING: to detach from a source of dependence (being weaned off the medication); also: to free from a usually unwholesome habit or interest (wean him off his drug use)WINO: informal + often disparaging: a person (especially a person without a permanent place of residence) who is habitually drunk on wine; also, somewhat informal: a wine enthusiast or connoisseur
Spelling Bee words related to
INTOXICANTS
ACIDACIDHEAD*ADDICTADDICTEDADDICTINGADDICTIONADDICTIVEALCOHOLALCOHOLICALCOPOPAPPLEJACKAROMABACCHANALBACCHANALIABACCHANALIANBACCHICBAKEDBEADYBEFUDDLEBEFUDDLEDBENTBETELBLINDBLOTTOBLOWBLUNTBOCKBOCKSBONDBONGBOOZEBOOZINGBOTTLEBOURBONBRANDYBRIARBRUTBUBBLYBUMPBURNOUTBUTTCAFFEINECANARYCANDYMANCANNACAVACHARDCHAWCHEWEDCHEWINGCHIANTICHICACIGARCLEANCOCACOCKTAILCOGNACCOKECORDIALCORKYCORNCORONACRACKCURACAODABBEDDABBINGDECKDEPENDENCEDEPENDENTDETOXDETOXEDDETOXIFIEDDIMEDIPPEDDIPPINGDOOBIEDOPEDOPEDDOPEYDOPINGDOPYDRAFTDRAGDRAGGINGDRANKDROPDROPPINGDRUGDRUGGINGDRUGGYEGGNOGETHANOLFILMFLAKEFLIGHTFLIPFORTIFYFORTYFRUITFUDDLEFUDDLEDGANJAGAVEGIMLETGIVEGIVENGIVINGGRAPPAGROGGROUTGUZZLINGHABITHANDHARDHEADHEADYHEELTAPHEMLOCKHEMPHIGHHOCKHOOCHHOOKAHHOPPEDHOPPYHUFFHUFFED
IMBIBEIMBIBEDIMBIBINGINTOXICANTINTOXICATIONJACKJOINTKICKKICKEDKICKINGLACELACEDLACINGLETHALLETHALLYLIGHTWEIGHTLINELOADLOADLOADEDLOADINGLONGNECKMAGNUMMAINLINEMALTMALTYMANHATTANMARGARITAMARIJUANAMARTINIMEADMELLOWMETHMIRINMIXOLOGYMUDDLEMUDDLEDMULEMULLMULLEDMULLINGNAIVENARCONEATNICKELNICOTINENIPPEDNIPPINGOAKYOENOLOGYOENOPHILEOPIOIDORGYOUZOPANATELAPELLICLEPEYOTEPINOTPIPEPLUGPOPPEDPOPPINGPORTPOTABLEPOTATION* POTATION* POTHEADPOTIONPROOFPUFFPUFFEDPULLQUAALUDEQUIDRACKRAWLYRIOJAROACHROCKROLLROTGUTROUNDRUMMY
SAKESAKESTANNICTANNINTARTARTEETOTALTIGHTTIPPLETIPPLINGTOBACCOTODDYTOKETOKINGTOOTTOOTEDTOOTHFUL*TOOTINGTOPETOPEDTOPINGTOUCHTOUCHEDTRANQTRIPTRIPPYVAPEVIRGINWEANWEANEDWEANINGWEEDWHETWHIFFWHITEWINEWINEDWININGWINOWINYWORKWORKINGWORTZOMBIE