LexiTopic: Animals
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to ANIMALS in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to ANIMALS
SUBJECT HEADINGS IN THIS LEXITOPIC:
AmphibiansAnimal Behavior general; not birdsAnimal Coloration generalAnimal Disease generalAnimal Groups generalAnimal Homes allAnimal Morphology generalAnimal Reproduction and Young general; not birdsAnimal Sounds all except birdsBirds: BehaviorBirds: Bird TypesBirds: Flight and FlockingBirds: Morphology and Plumage specific to birdsBirds: Reproduction and YoungBirds: SoundsBirds: Words about BirdsFishInsects, Arachnids, etc.Invertebrates NOCMammals: AntelopesMammals: BovineMammals: CanineMammals: Caprine (goats)Mammals: Cervine (deer)Mammals: EquineMammals: FelineMammals: Leporine (hares and rabbits)Mammals: MarineMammals: Marsupials and MonotremesMammals: OthersMammals: OvineMammals: PorcineMammals: PrimatesMammals: RodentsMicroorganismsMollusks and CrustaceansReptilesWords about Animals
NOTES ABOUT THE TAXONOMY FOR ANIMALS
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to wild animals of all types, as well as general terms about animal types, breeds, groups, behavior, movements, sounds, appearance, etc.
Words related to animal morphology, disease, behavior, natural reproduction, and sounds are here in ANIMALS. General terms about life, death, growth, reproduction, etc., are in BIOLOGY.
Words about the care and management of animals raised and kept for human consumption or use, including words related to human-managed breeding, are in AGRICULTURE AND FARM LIFE.
Words related to age, sex, condition, and reproductive status specifically of domestic and farm animals (e.g., plug, barrow, capon) are in AGRICULTURE AND FARM LIFE. Words related to those characteristic of animals in general, and of wild animals in particular, are here in ANIMALS.
Words in the subtopics for Animal Behavior, Disease, and Morphology are (usually) general to multiple species; terms specific to specific animals or animal families are listed in the subtopic for that animal or family.Words in Animal Sounds are also indexed with the relevant animals or animal groups. Due to volume [LOL], words about bird sounds are indexed separately in Birds: Sounds.
Words related to fishing (including commercial fishing), hunting, trapping, and animal sports and competitions are in SPORTS AND RECREATION.Words related to fur, leather, and fleece products from domestic and wild animals, including their processing, are in MANUFACTURING, PRODUCTS, AND PACKAGING.
Mythical creatures are in MYTH AND MAGIC.
Names of animals used as human epithets are in PEOPLE: CHARACTER AND APPEARANCE.
Topical arrangement of Spelling Bee words related to ANIMALS
Amphibians
AMPHIBIAN: an amphibious organism, especially: any of a class (Amphibia) of cold-blooded vertebrates (such as frogs, toads, or salamanders) intermediate in many characters between fish and reptiles and having gilled aquatic larvae and air-breathing adultsBULLFROG: a heavy-bodied deep-voiced frog (Rana catesbeiana) of the eastern U.S. and southern CanadaFROG: any of various largely aquatic leaping anuran amphibians (such as ranids) that have slender bodies with smooth moist skin and strong long hind legs with webbed feetFROGGY: abounding in frogs: of, relating to, or resembling frogsNEWT: any of various small salamanders (family Salamandridae) that are usually semiaquatic as adultsPOLLIWOG: M-W has main entry for pollywog, variants or polliwog: A tadpole, a larval amphibian; specifically: a frog or toad larva that has a rounded body with a long tail bordered by fins and external gills soon replaced by internal gills and that undergoes a metamorphosis to the adultRIBBIT: not in M-W; Collins has (used to suggest) the croaking of a frogTOAD: any of numerous anuran amphibians (especially family Bufonidae) that are distinguished from the related frogs by being more terrestrial in habit though returning to water to lay their eggs, by having a build that is squatter and shorter with weaker and shorter hind limbs, and by having skin that is rough, dry, and warty rather than smooth and moist
Animal Behavior general, not birds
ALPHA: a socially dominant person or animal; socially dominant especially in a group of animals (an alpha male)BITE: to seize especially with teeth or jaws so as to enter, grip, or wound; to wound, pierce, or sting especially with a fang or a proboscisBITING: to seize especially with teeth or jaws so as to enter, grip, or wound; to wound, pierce, or sting especially with a fang or a proboscisBITTEN: to seize especially with teeth or jaws so as to enter, grip, or wound; to wound, pierce, or sting especially with a fang or a proboscisCHARM: to control (an animal) typically by charms (such as the playing of music) (charm a snake)CLUTCH: the act of grasping, holding, or restraining; also, the claws or a hand in the act of grasping or seizing firmly (a rabbit in the clutch of a hawk); also, to grasp or hold with or as if with the hand or claws usually strongly, tightly, or suddenly; to seek to grasp and hold (clutched at her hand)CLUTCHED: the act of grasping, holding, or restraining; also, the claws or a hand in the act of grasping or seizing firmly (a rabbit in the clutch of a hawk); also, to grasp or hold with or as if with the hand or claws usually strongly, tightly, or suddenly; to seek to grasp and hold (clutched at her hand)CORRIDOR: a land path used by migrating animalsDOGTROT: a quick easy gait suggesting that of a dog
ECHOLOCATE: to find by echolocation, a physiological process for locating distant or invisible objects (such as prey) by sound waves reflected back to the emitter (such as a bat) from the objects (a bat echolocates food); also, to utilize or have the capacity for echolocation; from echo + locateETHOLOGY*: the scientific and objective study of animal behavior, groups, etc. especially under natural conditionsFEED: to prey —used with on, upon, or offFEEDING: to prey —used with on, upon, or offFLEW: to move in or pass through the air with wings (birds, insects, etc.)FLIGHT: to move in or pass through the air with wings (birds, insects, etc.)FLYING: to move in or pass through the air with wings (birds, insects, etc.)FORAGING: of animals: wandering in search of forage or foodGAIT: a sequence of foot movements (such as a walk, trot, pace, or canter) by which a horse or a dog moves forward; also, to train (a horse or a dog) to use a particular gait or set of gaitsGUANO: broadly: excrement especially of seabirds or batsHUNT: to pursue for food; to traverse in search of prey (hunts the woods); also, the act, the practice, or an instance of huntingHUNTED: to pursue for food; to traverse in search of prey (hunts the woods); also, the act, the practice, or an instance of huntingIMMIGRANT: a plant or animal that becomes established in an area where it was previously unknownLANGUAGE: the means by which animals communicate (the language of whales)LICK: a natural salt deposit (such as a salt spring) that animals lick; also, an act or instance of licking; also, to draw the tongue over; to lap with or as if with the tongue; to take into the mouth with the tongue: to lapLICKED: an act or instance of licking; also, to draw the tongue over; to lap with or as if with the tongue; to take into the mouth with the tongue: to lapLICKING: an act or instance of licking; also, to draw the tongue over; to lap with or as if with the tongue; to take into the mouth with the tongue: to lapMIGRANT: an animal (such as a gray whale, monarch butterfly, leatherback sea turtle, or Canada goose) that moves usually long distances from one habitat or geographic region to another; also, [of organisms] to change position or location in an organism or substance (filarial worms migrate within the human body)MIGRATING: [of animals] to pass usually periodically from one region or climate to another for feeding or breedingMIMIC: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICKED: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICKING: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICRY: superficial resemblance of one organism to another or to natural objects among which it lives that secures it a selective advantage (such as protection from predation)MODEL: an organism whose appearance a mimic imitatesPAWING: to touch or strike at with a paw; to scrape or beat with a hoof; to touch or strike with a paw; to beat or scrape something with a hoofPRICK: to cause to be or stand erect (a dog pricking its ears)RAPACITY: the quality of being rapacious, living on preyROOT: to turn up or dig in the earth with the snout: to grubTAME: reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated (tame animals); also, to reduce from a wild to a domestic state; to become tameTAMED: reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated (tame animals); also, to reduce from a wild to a domestic state; to become tameTAMELY: reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated (tame animals); also, to reduce from a wild to a domestic state; to become tameTAMING: reduced from a state of native wildness especially so as to be tractable and useful to humans: domesticated (tame animals); also, to reduce from a wild to a domestic state; to become tameTORPOR: a state of lowered physiological activity typically characterized by reduced metabolism, heart rate, respiration, and body temperature that occurs in varying degrees especially in hibernating and estivating animalsTRACK: a footprint whether recent or fossil; also, to carry (mud or other material) on the feet and deposit (tracking mud); also, to leave tracks; to make tracks uponTRACKWAY: a series of fossil footprints (as of a dinosaur)VAGRANT: an animal wandering outside its normal geographic range; (adj) wandering outside its normal geographic range
VOLANT: flying or capable of flyingWALK: the gait of a biped in which the feet are lifted alternately with one foot not clear of the ground before the other touches; also, the gait of a quadruped in which there are always at least two feet on the ground, specifically: a 4-beat gait of a horse in which the feet strike the ground in the sequence near hind, near fore, off hind, off fore; also, to cause (an animal) to go at a walk: to take for a walk (walking a dog); to compel to walk (as by a command)WALLOW: a muddy area or one filled with dust used by animals for wallowing; a depression formed by or as if by the wallowing of animals; an act or instance of wallowing; to roll oneself about in a lazy, relaxed, or ungainly manner (hogs wallowing in the mud)WALLOWED: a muddy area or one filled with dust used by animals for wallowing; a depression formed by or as if by the wallowing of animals; an act or instance of wallowing; to roll oneself about in a lazy, relaxed, or ungainly manner (hogs wallowing in the mud)WALLOWING: a muddy area or one filled with dust used by animals for wallowing; a depression formed by or as if by the wallowing of animals; an act or instance of wallowing; to roll oneself about in a lazy, relaxed, or ungainly manner (hogs wallowing in the mud)WILDLING: wilding [preferred]: a wild animalWING: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGED: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGING: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWORRY: to harass by tearing, biting, or snapping especially at the throat; to shake or pull at with the teeth (a terrier worrying a rat)
Animal Coloration general
ALBINO: an organism exhibiting deficient pigmentation; also, (adj) exhibiting the deficient pigmentation characteristic of albinosBALD: marked with white (a horse with a bald face)BAND: a stripe (as on an animal) differentiable (as by color, texture, or structure) from the adjacent material or areaBLACK: a black animal (such as a horse)BLAZE: a usually white stripe down the center of the face of an animalCALICO: a blotched or spotted animal, especially: one that is predominantly white with red and black patches; from Calicut, IndiaCOLLAR: any of various animal structures or markings similar to a collarCRYPTIC: serving to conceal (cryptic coloration in animals); also: exhibiting cryptic coloration (cryptic animals)DAPPLE: a dappled animalDAPPLED: a dappled animalHOOD: a color marking or crest on the head of an animal or an expansion of the head that suggests a hoodHOODED: having the head conspicuously different in color from the rest of the body (hooded bird)MARK: to furnish with natural marks (a bird’s wings marked with white; leaves marked with spots); also, a distinguishing trait or quality: a characteristicMELANIN: any of various black, brown, reddish-brown, reddish-yellow, or yellow pigments of living organisms that in animals are typically produced in melanocytes by the oxidation of tyrosine followed by polymerization and are found especially in skin, hair, feathers, and eyesPIED: of two or more colors in blotches; also: wearing or having a parti-colored coat (a pied horse)POINT: points plural: the extremities or markings of the extremities of an animal especially when of a color differing from the rest of the bodyROAN: [of an animal’s coat:] having the base color (such as red, black, or brown) muted and lightened by admixture of white hairs (a roan horse, a roan calf;TABBY: striped and mottled with darker color : brindled (a tabby cat)TICKING: ticked marking on a bird or mammal or on individual hairsTRICOLOR: a tricolor animal, especially: a tricolor dogWHITE: (noun) a white mammal (such as a horse or a hog)
Animal Disease general
BIGHEAD: any of several diseases of animals marked by swelling about the head BIGHEADED: any of several diseases of animals marked by swelling about the head BLOAT: digestive disturbance of ruminant animals and especially cattle marked by accumulation of gas in one or more stomach compartments; also, a condition of large dogs marked by distension and usually life-threatening rotation of the stomachGALL: a skin sore caused by chronic irritation; also, to fret and wear away by friction: to chafe (the loose saddle galled the horse's back); also, to become sore or worn by rubbingGALLED: to fret and wear away by friction: to chafe (the loose saddle galled the horse's back); also, to become sore or worn by rubbingGALLING: to fret and wear away by friction: to chafe (the loose saddle galled the horse's back); also, to become sore or worn by rubbingGAPE: a disease of birds and especially young birds in which gapeworms invade and irritate the tracheaHEAVE: heaves plural in form but singular or plural in construction, veterinary medicine: chronic pulmonary emphysema of the horse resulting in difficult expiration, heaving of the flanks, and a persistent coughMALARIA: any of various diseases of birds and mammals caused by blood protozoansMALARIAL: any of various diseases of birds and mammals caused by blood protozoansMANGE: any of various persistent contagious skin diseases marked especially by eczematous inflammation and loss of hair, affecting domestic animals or sometimes humans, and caused by a minute parasitic miteMANGY: affected with or resulting from mange, any of various persistent contagious skin diseases marked especially by eczematous inflammation and loss of hair, affecting domestic animals or sometimes humans, and caused by a minute parasitic miteRABID: affected with rabies, an acute virus disease of the nervous system of mammals that is caused by a rhabdovirus (species Rabies virus of the genus Lyssavirus) usually transmitted through the bite of a rabid animal and that is characterized typically by increased salivation, abnormal behavior, and eventual paralysis and death when untreatedROAR: to make a loud noise during inhalation (such as that of a horse affected with roaring, a noisy inhalation in a horse especially upon exercising that is caused by paralysis and muscular atrophy of part of the larynx)ROARING: to make a loud noise during inhalation (such as that of a horse affected with roaring, a noisy inhalation in a horse especially upon exercising that is caused by paralysis and muscular atrophy of part of the larynx)TYPHOID: a disease of domestic animals resembling human typhus or typhoidWILT: a viral disease of caterpillarsWRACK: a wreck: a person or animal of broken constitution, health, or spirits (he's a nervous wreck)
Animal Groups
BEVY: a group of animals and especially quailBLOOM: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)BLOOMED: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)BLOOMING: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)COLONY: a circumscribed mass of microorganisms usually growing in or on a solid medium (colonies of bacteria); also, the aggregation of zooids of a compound animal (such as a coral or bryozoan) (a coral colony)DRIFT: synonym of drove (n): a group of animals driven or moving in a bodyETHOLOGY*: the scientific and objective study of animal behavior, groups, etc. especially under natural conditionsFLOCK: a group of animals (such as birds or sheep) assembled or herded togetherPACK: a group of often predatory animals of the same kind (a pack of wolves); to gather into tight formation: also, to make a pack of (animals, such as hounds)PACKED: a group of often predatory animals of the same kind (a pack of wolves); to gather into tight formation: also, to make a pack of (animals, such as hounds)RAFT: an aggregation of animals (such as waterfowl) resting on the water (a raft of ducks)TEAM: a group of animals: such as a brood, especially of young pigs or ducksTROOP: a flock of mammals or birdsWAVE: a moving group of animals of one kind
Animal Homes
APIARY: a place where bees are kept, especially: a collection of hives or colonies of bees kept for their honeyAVIARY: a place for keeping birds confinedBEEHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of beesBURROW: a hole or excavation in the ground made by an animal (such as a rabbit) for shelter and habitationCOUCH: the den of an animal (such as an otter)FORM: the resting place or nest of a hareHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of bees; also, of bees: to enter and take possession of a hive; also, to collect into a hive; also, to store up in or as if in a hiveHIVED: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of bees; also, of bees: to enter and take possession of a hive; also, to collect into a hive; also, to store up in or as if in a hiveHIVING: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of bees; also, of bees: to enter and take possession of a hive; also, to collect into a hive; also, to store up in or as if in a hiveHOLE: an animal’s burrow, or the act of creating a burrow or going into oneHOLED: an animal’s burrow, or the act of creating a burrow or going into oneHOLING: an animal’s burrow, or the act of creating a burrow or going into oneHOLT: M-W does not have a definition for holt as an otter’s den or couchHOME: of an animal: to return accurately to one's native area of place of birth or origin from a distance: to return home (to nest, spawn, etc.)HOMED: of an animal: to return accurately to one's native area of place of birth or origin from a distance: to return home (to nest, spawn, etc.)HOMING: of an animal: to return accurately to one's native area of place of birth or origin from a distance: to return home (to nest, spawn, etc.)LAIR: the resting or living place of a wild animal: a denLODGE: a den or lair especially of gregarious animals (such as beavers)POUND: an enclosure for animals, especially: a public enclosure for stray or unlicensed animals (a dog pound)TOWN: a group of prairie dog burrowsTUNNEL: a burrow; also, to make or use a burrow; also, to make a tunnel or similar opening through or under; also: to make (one's way) by or as if by making a tunnelTUNNEL: a burrow; also, to make or use a burrow; also, to make a tunnel or similar opening through or under; also: to make (one's way) by or as if by making a tunnel
Animal Morphology general
ABDOMEN: the posterior section of the body behind the thorax in an arthropodANKLE: the joint between the cannon bone and pastern (as in the horse)ANTENNA: one of a pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansANTENNAE: the pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansBACK: the part of a lower animal (such as a quadruped) corresponding to the human backBELL: a bell-shaped organ or part (such as the dewlap of a moose), or the bell- or saucer-shaped, largely gelatinous structure that forms the main part of the body of most jellyfishBELLY: the undersurface of an animal's body; also: hide from this partBONE: any of various hard animal substances or structures (such as baleen or ivory) akin to or resembling boneBUILD: the bodily conformation of a person or animal (a horse of stocky build)BUTTOCK: the rump, the upper rounded part of the hindquarters of a quadruped mammalCANNON: the part of the leg in which the cannon bone is foundCHITIN: a horny polysaccharide (C8H13NO5)n that forms part of the hard outer integument especially of insects, arachnids, and crustaceansCIRRI: plural of cirrus: a slender usually flexible animal appendage or projectionCLAW: a sharp usually slender and curved nail on the toe of an animal; also, to rake, seize, dig, or progress with or as if with claws; to scrape, scratch, dig, or pull with or as if with clawsCLAWING: to rake, seize, dig, or progress with or as if with claws; to scrape, scratch, dig, or pull with or as if with clawsCLOACA: the common chamber into which the intestinal and urogenital tracts discharge especially in monotreme mammals, birds, reptiles, amphibians, and elasmobranch fishesCOAT: the external growth on an animalCOLLAR: any of various animal structures or markings similar to a collarCOXA: the basal segment of a limb of various arthropods (such as an insect)CRAW: the crop of a bird or insect, or the stomach especially of a lower animalCROUP: the rump of a quadrupedCUTICLE: an external envelope (as of an insect) secreted usually by epidermal cells; also, the outermost layer of animal integument composed of epidermis; also, the outermost membranous layer of a hair consisting of overlapping scales of epithelial cellsDIGIT: any of the divisions in which the limbs of most vertebrates terminate, which are typically five in number but may be reduced (as in the horse), and which typically have a series of phalanges bearing a nail, claw, or hoof at the tipDOCK: the solid part of an animal's tail as distinguished from the hairELBOW: a joint in the anterior limb of a lower vertebrate corresponding to the human armFACET: the external corneal surface of an ommatidium, one of the elements corresponding to a small simple eye that make up the compound eye of an arthropodFALL: long hair overhanging the face of dogs of some breedsFALLS: long hair overhanging the face of dogs of some breedsFANCILY: fancy: of an animal or plant: bred especially for bizarre or ornamental qualities that lack practical utilityFANG: a long sharp tooth: such as one by which an animal's prey is seized and held or tornFANGED: a long sharp tooth: such as one by which an animal's prey is seized and held or tornFELL: skin, hide, pelt; or a thin tough membrane covering a carcass directly under the hideFINNED: having a fin or finsFLAG: the tail of some dogs (such as a setter or hound); also: the long hair fringing a dog's tail; also, the tail of a deerFLAGELLA: plural of flagellum, any of various elongated filiform appendages of plants or animals: such as the slender distal part of an antenna; also, a long tapering process that projects singly or in groups from a cell and is the primary organ of motion of many microorganismsFLANK: the fleshy part of the side between the ribs and the hip; broadly: the side of a quadrupedFLEECE: the coat of wool covering a wool-bearing animal (such as a sheep)FLOAT: a sac containing air or gas and buoying up the body of a plant or animalFRILL: a ruff of hair or feathers or a bony or cartilaginous projection about the neck of an animalFURRY: consisting of or resembling fur, or covered with furGAPE: the opening formed by the open mouth of an animal (such as a bird, fish, or snake)GULLET: esophagus, throatHAIR: a slender threadlike outgrowth of the epidermis of an animal, especially: one of the usually pigmented filaments that form the characteristic coat of a mammal; also, the hairy covering of an animal or a body part, especially: the coating of hairs on a human headHAIRY: covered with hair or hairlike material, or made of or resembling hairHAND: the forelimb segment (such as the terminal section of a bird's wing) of a vertebrate higher than the fishes that corresponds to the hand irrespective of its form or functional specialization; also, a part serving the function of or resembling a hand: such as the hind foot of an ape; also, the terminal part of the vertebrate forelimb when modified (as in primates) as a grasping organ: the body part at the end of the arm of a human, ape, or monkey; also, the chela of a crustaceanHAUNCH: usually plural: hindquarters plural: the hind pair of legs of a quadruped; broadly: all the structures of a quadruped that lie posterior to the attachment of the hind legs to the trunkHEEL: the part of the hind limb of vertebrates that is similar in structure to the human heelHOCK: the tarsal joint or region in the hind limb of a digitigrade quadruped (such as the horse) corresponding to the human ankle but elevated and bending backwardHOODED: having a hood (hooded crane); having the head conspicuously different in color from the rest of the body (hooded bird); also, having a crest on the head that suggests a hood (hooded seals); also, having the skin at each side of the neck capable of expansion by movements of the ribs (a hooded cobra)HOOF: a curved covering of horn that protects the front of or encloses the ends of the digits of an ungulate mammal and that corresponds to a nail or claw; also, a hoofed foot especially of a horseHOOFED: having hoovesHORN: a permanent solid horn of keratin that is attached to the nasal bone of a rhinoceros; also, one of a pair of permanent bone protuberances from the skull of a giraffe or okapi that are covered with hairy skin; also, a natural projection or excrescence from an animal (e.g., an insect) resembling or suggestive of a hornHORNY: having hornsHUMP: a fleshy protuberance on the back of an animal (such as a camel, bison, or whale)IVORY: the hard creamy-white modified dentine that composes the tusks of a tusked mammal (such as an elephant, walrus, or narwhal); a tusk that yields ivoryJOINT: the point of contact between elements of an animal skeleton with the parts that surround and support itKNEE: the joint in the hind leg of a four-footed vertebrate that corresponds to the human knee; also, the carpal joint of the foreleg of a four-footed vertebrateLAMINA: one of the narrow thin parallel plates of soft vascular sensitive tissue that cover the flesh within the wall of a hoofLAMINAE: one of the narrow thin parallel plates of soft vascular sensitive tissue that cover the flesh within the wall of a hoofLAMINAL: arranged in, consisting of, or resembling laminae; a lamina is one of the narrow thin parallel plates of soft vascular sensitive tissue that cover the flesh within the wall of a hoofLEGGED: having a leg or legs especially of a specified kind or number —often used in combinationLEGGY: having many legsLIMB: one of the projecting paired appendages (such as wings) of an animal body used especially for movement and grasping but sometimes modified into sensory or sexual organsLITTLE: of a plant or animal: small in comparison with related forms —used in vernacular names (little egret)LOBAR*: of or relating to a lobe, a curved or rounded projection or division. specifically: a usually somewhat rounded projection or division of a bodily organ or partLOBE: a curved or rounded projection or division; specifically: a usually somewhat rounded projection or division of a bodily organ or partLOBED: having lobes, a curved or rounded projection or division; specifically: a usually somewhat rounded projection or division of a bodily organ or partLOIN: the part of a human being or quadruped on each side of the spinal column between the hip bone and the false ribsLUNG: one of the usually paired compound saccular thoracic organs that constitute the basic respiratory organs of an air-breathing vertebrate; also, any of various respiratory organs of invertebratesMAIL: a hard enclosing covering of an animal (such as a tortoise)MAMMA: a mammary gland and its accessory partsMAMMARY: of, relating to, lying near, or affecting the mammaeMANE: long and heavy hair growing about the neck and head of some mammals (such as horses and lions)MARK: to furnish with natural marks (a bird’s wings marked with white; leaves marked with spots); also, a distinguishing trait or quality: a characteristicMAXILLA: the jaw; especially an upper jaw especially of humans and other mammals in which the bony elements are closely fused; also, either of the two bones that lie with one on each side of the upper jaw lateral to the premaxilla and that in higher vertebrates bear most of the teeth: MIMIC: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICKED: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICKING: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICRY: superficial resemblance of one organism to another or to natural objects among which it lives that secures it a selective advantage (such as protection from predation)MODEL: an organism whose appearance a mimic imitatesMOLT: to shed hair, feathers, shell, horns, or an outer layer periodically; to cast off (an outer covering) periodically; specifically, to throw off (the old cuticle —used of arthropods; also, the act or process of moltingMORPH: a local population of a species that consists of interbreeding organisms and is distinguishable from other populations by morphology or behavior though capable of interbreeding with them; a phenotypic variant of a speciesMOUTH: the natural opening through which food passes into the body of an animal and which in vertebrates is typically bounded externally by the lips and internally by the pharynx and encloses the tongue, gums, and teethNAIL: a structure (such as a claw) that terminates a digit and corresponds to a nailNAKED: of an animal or one of its parts: lacking an external covering (as of hair, feathers, or shell) (naked amoebas)NECK: the part of an animal that connects the head with the bodyNIPPLE: the protuberance of a mammary gland upon which in the female the lactiferous ducts open and from which milk is drawnORGAN: a differentiated structure (such as a heart, kidney, leaf, or stem) consisting of cells and tissues and performing some specific function in an organism; also, bodily parts performing a function or cooperating in an activity (the eyes and related structures that make up the visual organs)PART: one of the constituent elements of a plant or animal body: such as an organ or memberPAUNCH: the rumen, the large first compartment of the stomach of a ruminant in which cellulose is broken down by the action of symbiotic microorganismsPILE: a coat or surface of usually short close fine furry hairsPLATE: a thin relatively flat anatomical part (such as a lamina of bone) of an animal body, especially: a scute, an external bony or horny plate or large scalePLUME: an animal structure having a main shaft bearing many hairs or filamentous parts, especially: a full bushy tailPOCKET: a superficial pouch in some animalsPRONG: a fang of a toothRADII: plural of radius, a part of some vertebrate animals (above the fishes) that corresponds to the bone on the thumb side of the human forearmRANGY: long-limbed and long-bodied (rangy cattle)ROUGH: covered with or made up of coarse and often shaggy hair (rough-coated collie) (compare smooth, wirehaired)RUFF: a fringe or frill of long hairs or feathers growing around or on the neck of an animalRUMP: the upper rounded part of the hindquarters of a quadruped mammalTAIL: the rear end or a process or prolongation of the rear end of the body of an animalTALON: the claw of an animal and especially of a bird of preyTEAT: the protuberance through which milk is drawn from an udder or breast: nippleTEETH: one of the hard bony appendages that are borne on the jaws or in many of the lower vertebrates on other bones in the walls of the mouth or pharynx and serve especially for the prehension and mastication of food and as weapons of offense and defense; also, any of various usually hard and sharp processes especially about the mouth of an invertebrateTEMPLE: the flattened space on each side of the forehead of some mammals including humansTENTACLE: any of various elongated flexible usually tactile or prehensile processes borne by invertebrate animals chiefly on the head or about the mouthTHIGH: the segment of the leg immediately distal to the thigh in a bird or in a quadruped in which the true thigh is obscuredTHORACIC: of, relating to, located within, or involving the thorax, the part of the vertebrate body between the neck and the abdomenTHORN: any of various sharp spiny structures on an animalTHYROID: short for thyroid gland, a large bilobed endocrine gland of vertebrates lying at the anterior base of the neck and producing especially the hormones thyroxine and triiodothyronine; of, relating to, or being the thyroid glandTIBIA: the inner and usually larger of the two bones of the vertebrate hind or lower limb between the knee and ankle
TIBIAE: plural of tibia, the inner and usually larger of the two bones of the vertebrate hind or lower limb between the knee and ankleTIBIAL: related to the tibia, the inner and usually larger of the two bones of the vertebrate hind or lower limb between the knee and ankleTOED: having a toe or toes especially of a specified kind or number —usually used in combination (five-toed sloth)TONGUE: a fleshy movable muscular process of the floor of the mouths of most vertebrates that bears sensory end organs and small glands and functions especially in taking and swallowing food and in humans as a speech organ; also, a part of various invertebrate animals that is analogous to the tongueTONGUED: having a tongue especially of a specified kind —often used in combination (long-tongued, black-tongued)TOOTH: one of the hard bony appendages that are borne on the jaws or in many of the lower vertebrates on other bones in the walls of the mouth or pharynx and serve especially for the prehension and mastication of food and as weapons of offense and defense; also, any of various usually hard and sharp processes especially about the mouth of an invertebrateTOPKNOT: a crest of feathers or tuft of hair on the top of the headTUFT: a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends (a tuft of hair/feathers); also, to form into or grow in tuftsTUFTED: having a tuft or tufts, a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends (a tuft of hair/feathers); also, to form into or grow in tuftsTYPE: the typical or ideal characteristics (as body form, coat color, and temperament) that define a breed of animal (such as a dog)ULNA: plural ulnae or ulnas: the bone on the little-finger side of the human forearm; also: a corresponding part of the forelimb of vertebrates above fishesULNAE: plural of ulna, the bone on the little-finger side of the human forearm; also: a corresponding part of the forelimb of vertebrates above fishesULNAR: of or related to the ulna, the bone on the little-finger side of the human forearm; also: a corresponding part of the forelimb of vertebrates above fishesUNGULATE: having hooves (ungulate mammals) VAGINA: a canal in a female mammal that leads from the uterus to the external orifice of the vulva; also, a canal that is similar in function or location to the vagina and occurs in various animals other than mammalsVAGINAL: of, relating to, or affecting the genital vagina, a canal in a female mammal that leads from the uterus to the external orifice of the vulva; also, a canal that is similar in function or location to the vagina and occurs in various animals other than mammals; also, of or relating to a theca, an enveloping sheath or case of an animal or animal partVEIL: a covering body part or membrane: such as the velum, a membrane or membranous part resembling a veil or curtain: such as an annular membrane projecting inward from the margin of the bell in some jellyfishes (such as the hydromedusae); also, a swimming organ that is especially well developed in the later larval stages of many marine gastropodsVELUM: a membrane or membranous part resembling a veil or curtain: such as an annular membrane projecting inward from the margin of the bell in some jellyfishes (such as the hydromedusae); also, a swimming organ that is especially well developed in the later larval stages of many marine gastropodsVENT: the external opening of the rectum or cloaca: anusWEBBED: [having or resembling a web,] a tissue or membrane of an animal or plantespecially: that uniting fingers or toes either at their bases (as in humans) or for a greater part of their length (as in many waterbirds)WING: one of the movable feathered or membranous paired appendages by means of which a bird, bat, or insect is able to fly; also: such an appendage (as of an ostrich or penguin) not used for flight; also, any of various anatomical structures (as of a flying fish or sugar glider) providing means of limited flightWINGED: one of the movable feathered or membranous paired appendages by means of which a bird, bat, or insect is able to fly; also: such an appendage (as of an ostrich or penguin) not used for flight; also, any of various anatomical structures (as of a flying fish or sugar glider) providing means of limited flight; having wings (winged insects); having wings of a specified kind —used in combination (strong-winged, long-winged)WOOL: the soft wavy or curly usually thick undercoat of various hairy mammals and especially the sheep made up of a matrix of keratin fibers and covered with minute scales
Animal Reproduction and Young general; not specific to birds
ALBUMEN: the white of an egg
ATTRACTANT: a substance (such as a pheromone) that attracts specific animals (such as insects or individuals of the opposite sex)BLOODED: being entirely or largely purebredBROOD: (adj.) kept for breeding (a brood mare); also, to sit on or incubate (eggs); to produce by or as if by incubation: hatch; of a bird: to cover (young) with the wings; also, the young of an animal or a family of young, especially: the young (as of a bird or insect) hatched or cared for at one timeCOURT: of an animal: to perform actions in order to attract for mating (a male bird courting a female); to engage in activity leading to mating (a pair of robins courting in the trees)DROP: of an animal: to give birth to (drop a calf)DROPPING: of an animal: to give birth to (drop a calf)FEMALE: an individual of the sex that is typically capable of bearing young or producing eggs, or of, relating to, or being the sex that typically has the capacity to bear young or produce eggsHEAT: sexual excitement especially in a female mammal (like an animal in heat); specifically: estrus: a regularly recurrent state of sexual receptivity during which the female of most mammals will accept the male and is capable of conceivingHOMOGAMY: the mating of like with likeJOEY: Australia: a baby animal, especially: a baby kangarooKITTEN: an immature or young individual of various other small mammalsLAID: to lay: to bring forth and deposit (an egg)LARVA: the early form of an animal (such as a frog or sea urchin) that at birth or hatching is fundamentally unlike its parent and must metamorphose before assuming the adult charactersLARVAL: the early form of an animal (such as a frog or sea urchin) that at birth or hatching is fundamentally unlike its parent and must metamorphose before assuming the adult charactersLAYING: to lay: to bring forth and deposit (an egg)MATE: either member of a breeding pair of animals; also, to become matedMATED: either member of a breeding pair of animals; also, to become matedMATING: either member of a breeding pair of animals; also, to become matedMILK: a fluid secreted by the mammary glands of females for the nourishment of their young; also, lactation (cows in milk); also, to draw milk from the breasts or udder of; to draw (milk) from the breast or udder; to draw or yield milk; also, to suckle —used of domestic animalsMONOGAMY: zoology: the condition or practice of having a single mate during a period of timeMOUNT: to climb on top of for copulationMOUNTED: to climb on top of for copulationMULE: a usually sterile hybridMULTIPLY: to become greater in number; to spread; to breed, to propagateORPHAN: a young animal that has lost its motherOVARY: one of the typically paired essential female reproductive organs that produce eggs and in vertebrates female sex hormonesOVULAR: of or relating to an ovule or ovum (a female gamete: macrogamete, called also egg cell)OVULE: a small egg, especially: one in an early stage of growthPUPPY: a young domestic dog, specifically: one less than a year oldPUPPYLIKE: a young domestic dog, specifically: one less than a year oldRIDING: to mount in copulation —used of a male animalRUNT: an animal unusually small of its kind, especially: the smallest of a litter of pigsRUNTY: an animal unusually small of its kind, especially: the smallest of a litter of pigsTHROW: to give birth to (threw large litters)THROWN: to give birth to (threw large litters)TWIN: either of two offspring produced in the same pregnancy; also, (adj) born with one other or as a pair at one birth (twin calves); also, to bring forth twinsTWINNING: either of two offspring produced in the same pregnancy; also, (adj) born with one other or as a pair at one birth (twin calves); also, to bring forth twinsUNWEANED: not accustomed to taking food otherwise than by nursing: not weaned(unweaned kittens, an unweaned foal) (the baby is yet unweaned)VEIL: a covering body part or membrane: such as the caul, the inner fetal membrane of higher vertebrates especially when covering the head at birthVIRGIN: a female animal that has never copulatedWEAN: to accustom (a young child or animal) to take food otherwise than by nursingWEANED: to accustom (a young child or animal) to take food otherwise than by nursingWEANING: to accustom (a young child or animal) to take food otherwise than by nursingWHELP: any of the young of various carnivorous mammals and especially of the dog; also, to give birth to —used of various carnivores and especially the dog; to bring forth youngYEAN*: to bring forth young —used of a sheep or goatYOUNG: (plural noun) immature offspring —used especially of animals; also, a single recently born or hatched animal; also (adj) being in the first or an early stage of life, growth, or development
Animal Sounds not birds
BAAED: to make the bleat of a sheepBAAING: to make the bleat of a sheepBARK: to make the characteristic short loud cry of a dog; to make a noise resembling a barkBAYED: to bark with prolonged tonesBAYING: to bark with prolonged tonesBELL: to make a resonant bellowing or baying sound; to bellow or roarBELLED: to make a resonant bellowing or baying sound; to bellow or roarBELLING: to make a resonant bellowing or baying sound; to bellow or roarBELLOW: to make the loud deep hollow sound characteristic of a bullBELLOWED: to make the loud deep hollow sound characteristic of a bullBLAT: alteration of bleat, to cry like a calf or sheep: to bleat; also, the sound made by blattingBLEAT: or blat, the cry of a sheep or goat; also, to make the natural cry of a sheep or goatBOWWOW: the bark of a dog, or a dogBRAY: to utter the characteristic loud harsh cry of a donkey; to utter a sound like a donkey'sBRAYING: to utter the characteristic loud harsh cry of a donkey; to utter a sound like a donkey'sBUGLING: to utter the characteristic rutting call of the bull elkCALL: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLED: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLING: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCHIRP: the characteristic short sharp sound especially of a small bird or insect; also, to make a chirp or a sound resembling a chirpCROAK: a hoarse harsh cry or sound; also, to make a deep harsh soundCROAKY: a hoarse harsh cry or sound; also, to make a deep harsh soundCRYING: to utter a characteristic sound or call (heard the seagulls crying)DUMB: lacking the human power of speech (dumb animals)GNARL: to snarl or growlGNARLING: to snarl or growlGROWL: a deep guttural inarticulate soundGRUNT: the deep short sound characteristic of a hogHEEHAW: M-W hyphenates hee-haw, the bray of a donkeyHEEHAWED: M-W hyphenates hee-haw, the bray of a donkeyHOWL: to emit a loud sustained doleful sound characteristic of members of the dog familyHOWLING: to emit a loud sustained doleful sound characteristic of members of the dog familyLOWED: of a cow: to moo, to make the throat noise of a cowLOWING: of a cow: to moo, to make the throat noise of a cowMEOW: the cry of a catMEOWED: the cry of a catMEOWING: the cry of a catMEWED: to utter a mew or similar sound; to utter by mewing: to meowMEWING: to utter a mew or similar sound; to utter by mewing: to meowMOOED: to make the throat noise of a cowMOOING: to make the throat noise of a cowNEIGH: to make the prolonged cry of a horseNEIGHED: to make the prolonged cry of a horseNEIGHING: to make the prolonged cry of a horseOINK: the natural noise of a hogOINKING: the natural noise of a hogPURR: a low vibratory murmur typical of an apparently contented or pleased cat; also, to make a purr or a sound like a purr (cars purring along the highway)PURRING: a low vibratory murmur typical of an apparently contented or pleased cat; also, to make a purr or a sound like a purr (cars purring along the highway)RIBBIT: not in M-W; Collins has (used to suggest) the croaking of a frogROAR: the deep cry of a wild animal (such as a lion); also, to make the loud sound of a wild animalROARING: the deep cry of a wild animal (such as a lion); also, to make the loud sound of a wild animalTONGUE: the cry of or as if of a hound pursuing or in sight of game —used especially in the phrase to give tongueTWEET: a chirping note; also, to make a chirping soundTWEETED: a chirping note; also, to make a chirping soundWHINNIED: the neigh of a horse especially when low or gentle; also, to neigh especially in a low or gentle wayWHINNY: the neigh of a horse especially when low or gentle; also, to neigh especially in a low or gentle wayWHINNYING: the neigh of a horse especially when low or gentle; also, to neigh especially in a low or gentle wayWHOOP: the loud cry or call of an animal (such as an owl, whooping crane, or gibbon) that resembles the sound of the word whoop; also, to utter the cry or call of an animal (such as an owl or gibbon)WHOOPING: the loud cry or call of an animal (such as an owl, whooping crane, or gibbon) that resembles the sound of the word whoop; also, to utter the cry or call of an animal (such as an owl or gibbon)WOOF: a low gruff sound typically produced by a dog; also, to make the low gruff sound typically produced by a dogWOOFED: a low gruff sound typically produced by a dog; also, to make the low gruff sound typically produced by a dogWOOFING: a low gruff sound typically produced by a dog; also, to make the low gruff sound typically produced by a dogYAPPED: to bark snappishly: to yelpYAPPY: [of a dog] given to yapping, to bark snappishly: to yelpYAPPY: resembling or characteristic of a yap, a quick sharp bark: a yelpYELP: a sharp shrill bark or cry (as of a dog); a squeal; to utter a sharp quick shrill cry (dogs yelp); to utter with a yelpYELPED: a sharp shrill bark or cry (as of a dog); a squeal; to utter a sharp quick shrill cry (dogs yelp); to utter with a yelpYIPPING: to bark sharply, quickly, and often continuouslyYOWL: a loud long mournful wail or howl (as of a cat); also, to utter a loud long cry of grief, pain, or distress: to wail; to complain or protest with or as if with yowls; to express with yowling
Birds: Behavior
BATE: of a falcon or hawk: to attempt to fly off something (such as a gauntlet) in fearBATED: of a falcon or hawk: to attempt to fly off something (such as a gauntlet) in fearDABBLING: of a bird: to reach with the bill to the bottom of shallow water in order to obtain food; adjective: dabbling ducks, those who dabble (as opposed to diving ducks)GRIT: of birds: to consume particles of sand or grit to aid in digestionGRITTING: of birds: to consume particles of sand or grit to aid in digestionHAWK: to hunt (someone or something) in flight like a hawk (e.g., birds hawking after insects)MANTLE: [this definition not in M-W] to spread the wings over, as a bird of prey does after a captureMOBBED: to crowd about and attack or annoy (mobbed by autograph hunters, a crow mobbed by songbirds); to crowd into or aroundMOBBING: to crowd about and attack or annoy (mobbed by autograph hunters, a crow mobbed by songbirds); to crowd into or aroundMUTE: of a bird: to evacuate the cloacaMUTED: of a bird: to evacuate the cloacaMUTING: of a bird: to evacuate the cloacaPECK: to pick up with the bill (as a bird)PECKED: to pick up with the bill (as a bird)PELLET: a wad of indigestible material (as of bones and fur) regurgitated by a bird of preyPLUME: of a bird: to preen and arrange the feathers of (itself); to preen and arrange (feathers)PLUMED: of a bird: to preen and arrange the feathers of (itself); to preen and arrange (feathers)VAGRANT: a bird found outside its normal geographic range or migration route: an accidental, a bird found outside its normal geographic range, migration route, or season; (adj) found outside its normal geographic range or migration route: accidental
Birds: Bird Types
AMAZON: M-W often capitalized: any of a genus (Amazona) of tropical American parrots typically having green plumage marked with other bright colors, named for the belief that they were native to Amazonian jungles,AUKS: any of several black-and-white short-necked diving seabirds of the alcid family that breed in colder parts of the northern hemisphereAVOCET: any of a genus (Recurvirostra) of rather large long-legged shorebirds with webbed feet and slender upward-curving billBANTAM: a small chicken, named for Bantam, former village in Java where the birds are believed to have originatedBIDDY: a hen, a female chicken especially over a year old; also, a young chickenBIRD: a game birdBLACKCAP: any of several birds with black heads or crowns: such as a small gray European warbler (Sylvia atricapilla) with a black crown, or a chickadeeBOBOLINK: an American migratory songbird (Dolichonyx oryzivorus) with the breeding male chiefly black; the name is imitative of the bird’s tinkling songBOOBY: any of several tropical seabirds (genus Sula) of the gannet familyBUNTING: any of various stout-billed passerine birds (families Cardinalidae and Emberizidae) of which some are grouped with the cardinal and some with the New World sparrowsCANARY: a small finch (Serinus canarius synonym S. canaria) of the Canary Islands that is usually greenish to yellow and is kept as a cage bird and singerCAPON: a castrated male chickenCATBIRD: an American songbird (Dumetella carolinensis) that is dark gray in color with a black cap and reddish coverts under the tail and is related to the mockingbirdCHAT: any of several songbirds (as of the genera Cercomela, Granatellus, or Icteria)CHICK: a domestic chicken, especially: one newly hatchedCHICKADEE: any of several small North American oscine birds (genus Poecile of the family Paridae) that are related to the titmice…CHICKEN: the common domestic fowl (Gallus gallus) especially when young; also, any of various birds or their youngCOBS: plural of cob, [perhaps short for cobswan lead swan]: a male swanCOCK: a woodcock: a shorebird (Scolopax rusticola) of Europe and Asia that frequents moist woodlands, has large eyes and rounded wings, is of a variously mottled reddish-brown, black, and buff color with a barred chest, and is often hunted as game, or smaller related bird (Scolopax minor synonym Philohela minor) chiefly of eastern North America with a similar color pattern but having a solid orange buff chest; also, the adult male of any of several bird species, especially the adult male of the domestic chicken (gallus gallus): roosterCOCKATOO: any of various large noisy chiefly Australasian crested parrots (family Cacatuidae and especially genus Cacatua)COLT: M-W does not have this definition: a young Sandhill Crane CONDOR: a very large American vulture (Vultur gryphus) of the high Andes … the Andean condor or the California condor COOT: any of various slaty-black birds (genus Fulica) of the rail family, or any of several North American scoters (“sea coots”)CORMORANT: any of various dark-colored web-footed waterbirds (family Phalacrocoracidae, especially genus Phalacrocorax) that have a long neck, hooked bill, and distensible throat pouchCROW: any of various large usually entirely glossy black passerine birds (family Corvidae and especially genus Corvus)CUCKOO: a largely grayish-brown European bird (Cuculus canorus) that is a parasite given to laying its eggs in the nests of other birds which hatch them and rear the offspring; broadly any of a large family (Cuculidae of the order Cuculiformes) to which this bird belongs DODO: an extinct heavy flightless bird (Raphus cucullatus synonym Didus ineptus of the family Raphidae) of the island of Mauritius that was larger than a turkey and was related to the pigeon; or an extinct flightless bird (Raphus solitarius) of the island of Réunion similar to and closely related to the dodoDOVE: any of numerous pigeons, especially: a small wild pigeonDUCK: any of various swimming birds (family Anatidae, the duck family) in which the neck and legs are short, the feet typically webbed, the bill often broad and flat, and the sexes usually different from each other in plumage; also, a female duck, as opposed to drakeEAGLE: any of various large diurnal birds of prey (family Accipitridae) noted for their strength, size, keenness of vision, and powers of flightEAGLET: a young eagleFANTAIL: a domestic pigeon having a broad rounded tail often with 30 or 40 feathersFINCH: any of numerous passerine songbirds (families Fringillidae, Estrildidae, Emberizidae, and Cardinalidae) having a short stout usually conical bill adapted for crushing seedsFOWL: a bird of any kind; also, any of several wild gallinaceous birds (e.g., Guinea Fowl); also, a cock or hen of the domestic chicken (Gallus gallus), especially: an adult hen; also, any of several domesticated or wild gallinaceous birds (e.g., Guinea Fowl)GANNET: any of a genus (Morus of the family Sulidae, the gannet family) of large fish-eating seabirds that breed in colonies chiefly on offshore islandsGOONY: M-W: variant of gooney, the Black-footed Albatross, an albatross (Diomedea nigripes) of the Pacific that is chiefly blackish with dusky bill and black feet and legsGULL: any of numerous long-winged web-footed aquatic birds (subfamily Larinae of the family Laridae)HALCYON: a kingfisher, any of numerous nonpasserine birds (family Alcedinidae) that are usually crested and bright-colored with a short tail and a long stout sharp bill, or of or relating to the halcyon (kingfisher) or its nesting periodHAWK: any of numerous diurnal birds of prey belonging to a suborder (falcones of the order falconiformes) and including all the smaller members of this group; especially: accipiterHOBBY: a small Old World falcon (Falco subbuteo) that is dark blue above and white below with dark streaking on the breastHOODIE: informal: the hooded merganser (Lophodytes cucullatus)HOOPOE: any of a genus (Upupua of the family Upupidae) of crested Old World nonpasserine birds having a slender decurved bill and barred black-and-white wings and tailJACK: any of several birds (such as a jackdaw)JAYBIRD: a predominantly fawn-colored Old World bird (Garrulus glandarius) of the crow family with a black-and-white crest and wings marked with black, white, and blue; also, any of various usually crested and largely blue chiefly New World birds that are related to the common Old World jay and have roving habits and harsh voicesJUNCO: any of a genus (Junco of the family Emberizidae) of small widely distributed North American finches usually having a pink bill, ashy gray head and back, and conspicuous white lateral tail feathersKITE: any of various usually small hawks (family Accipitridae) with long narrow wings and often a notched or forked tailKIWI: any of a small genus (Apteryx) of flightless New Zealand birds with rudimentary wings, stout legs, a long bill, and grayish brown hairlike plumageKNOT: either of two sandpipers (Calidris canutus and C. tenuirostris) that breed in the Arctic and winter in temperate or warm parts of the New and Old WorldLARK: any of a family (Alaudidae) of chiefly Old World ground-dwelling songbirds that are usually brownish in color, especially: skylarkLINNET: a common small brownish Old World finch (Acanthis cannabina) of which the male has red on the breast and crown during breeding seasonLOON: any of several large birds (genus Gavia of the family Gaviidae) of Holarctic regions that feed on fish by diving and have their legs placed far back under the body for optimal locomotion underwaterMALLARD: common and widely distributed wild duck (Anas platyrhynchos) of the northern hemisphere the males of which have a green head and white-ringed neck and which is the source of the domestic ducksMARTIN: a small Eurasian bird (Delichon urbica) of the swallow family with a forked tail, bluish-black head and back, and white rump and underparts; also, any of various birds (especially genus Progne) of the swallow family other than the Eurasian martin, probably from St. MartinMYNA: or mynah: any of various Asian starlings (especially genera Acridotheres and Gracula), especially: a dark brown slightly crested bird (A. tristis) of southeastern Asia with a white tail tip and wing markings and bright yellow bill and feetMYNAH: or myna: any of various Asian starlings (especially genera Acridotheres and Gracula), especially: a dark brown slightly crested bird (A. tristis) of southeastern Asia with a white tail tip and wing markings and bright yellow bill and feetNENE: an endangered goose (Branta sandvicensis synonym Nesochen sandvicensis) of the Hawaiian Islands that usually inhabits waterless uplands and feeds on berries and vegetationNUTHATCH: any of various small tree-climbing chiefly insectivorous birds (family Sittidae and especially genus Sitta) that have a compact body, a narrow bill, a short tail, and sometimes a black capOWLET: a small or young owl, any of an order (Strigiformes) of chiefly nocturnal birds of prey with a large head and eyes, short hooked bill, strong talons, and soft fluffy often brown-mottled plumagePARROT: any of numerous widely distributed tropical birds (order Psittaciformes and especially family Psittacidae) that are often crested and brightly colored, have a distinctive stout hooked bill and zygodactyl feet, and include some excellent mimicsPEAFOWL: any of three very large terrestrial pheasants (Pavo cristatus and P. muticus of southeastern Asia and Afropavo congensis of central Africa) often raised as ornamental fowls due to their usually colorful, iridescent plumage and especially for the long, trailing tail coverts of the male which can be held more or less erect and outspreadPEAHEN: a female peafowl, any of three very large terrestrial pheasants (Pavo cristatus and P. muticus of southeastern Asia and Afropavo congensis of central Africa) often raised as ornamental fowls due to their usually colorful, iridescent plumage and especially for the long, trailing tail coverts of the male which can be held more or less erect and outspreadPEEP: any of several small sandpipersPEEWEE: the pewee, any of various small largely gray or olive-colored American flycatchers (genus Contopus)PELICAN: any of a genus (Pelecanus) of large web-footed fish-eating birds with a very large bill and distensible gular pouchPENGUIN: any of various erect short-legged flightless aquatic birds (family Spheniscidae) of the southern hemispherePEWEE: or peewee, any of various small largely gray or olive-colored American flycatchers (genus Contopus)PINTAIL: a bird having elongated central tail feathers, especially: a slender long-necked duck (Anas acuta) of the northern hemisphere with the breeding male having a brown head, a white breast with a white line continuing up the side of the neck, chiefly gray upperparts, and a long black tail and with the female having chiefly mottled brown plumagePIPIT: any of various small songbirds (family Motacillidae and especially genus Anthus) resembling the lark
PLOVER: any of a family (Charadriidae) of shorebirds that differ from the sandpipers in having a short hard-tipped bill and usually a stouter more compact build; also, any of various birds (such as a turnstone or sandpiper) related to the ploversPOULTRY: domesticated birds kept for eggs or meatPRION: any of several small petrels (genus Pachyptila of the family Procellariidae) of the southern hemisphere that are bluish gray above and white belowPUFFIN: any of several seabirds (genus Fratercula) of the northern hemisphere having a short neck and a deep grooved parti-colored laterally compressed billRAIL: any of numerous wading birds (family Rallidae, the rail family) that are of small or medium size and have short rounded wings, a short tail, and usually very long toes which enable them to run on the soft mud of marshesRAPTOR: a carnivorous medium- to large-sized bird (such as a hawk, eagle, owl, or vulture) that has a hooked beak and large sharp talons and that feeds wholly or chiefly on meat taken by hunting or on carrion: a bird of preyREEVE: the female of the ruff (sandpiper), a common Eurasian sandpiper (Calidris pugnax synonym Philomachus pugnax) whose male during the breeding season has a large ruff of erectile feathers on the neckRAPTOR: a carnivorous medium- to large-sized bird (such as a hawk, eagle, owl, or vulture) that has a hooked beak and large sharp talons and that feeds wholly or chiefly on meat taken by hunting or on carrion: a bird of preyROBIN: a large North American thrush (Turdus migratorius) with brownish-gray upperparts, blackish head and tail, black and whitish streaked throat, and dull reddish breast and underparts; called also American robin; also, a small chiefly European Old World flycatcher (Erithacus rubecula) having a brownish-olive back and orangish face and breast; also, any of various Old World songbirds that are related to or resemble the European robinROOK: a common Old World gregarious crow (Corvus frugilegus) that nests and roosts in usually treetop coloniesRUFF: a common Eurasian sandpiper (Calidris pugnax synonym Philomachus pugnax) whose male during the breeding season has a large ruff of erectile feathers on the neckSKUA: any of various seabirds (genus Sterocorarius) related to the jaegers: such as the great skua; also, a bird (S. maccormicki) that resembles but is slightly smaller than the great skua and that breeds in the AntarcticSKUAS: any of various seabirds (genus Sterocorarius) related to the jaegers: such as the great skua; also, a bird (S. maccormicki) that resembles but is slightly smaller than the great skua and that breeds in the AntarcticTEAL: any of various widely distributed small short-necked dabblers (genus Anas) (i.e., dabbling ducks)TELLTALE: the greater yellowlegs, a common North American bird (Tringa melanoleuca) of marsh and shore that is largely gray above and white below with black or dark gray flecks and yellow legs, so called because its loud calls give away its presenceTITMICE: plural of titmouse, any of several small North American oscine birds (genus Baeolophus of the family Paridae) that are related to the chickadees, have small bills and usually long tails, and have been sometimes placed especially formerly in a related genus (Parus)TOCK: an African hornbill of the genus TockusTOMTIT: any of various small active birds; probably short for tomtitmouse, from the name Tom + titmouseTOUCAN: any of a family (Ramphastidae) of chiefly fruit-eating birds of tropical America with brilliant coloring and a very large but light and thin-walled billTOWHEE: a long-tailed passerine bird (Pipilo erythrophthalmus of the family Passerellidae) of eastern North America with the male having reddish sides, white underparts, and black upperparts, head, and neck; called also chewink; also, any various similar related birds (genera Pipilo and Melozone) found mainly in western North AmericaWHIPPOORWILL: or less commonly whip-poor-will, a nocturnal nightjar (Antrostomus vociferus synonym Caprimulgus vociferus) of chiefly eastern North America with a loud repeated call suggestive of its nameWOODCOCK: a shorebird (Scolopax rusticola) of Europe and Asia that frequents moist woodlands, has large eyes and rounded wings, is of a variously mottled reddish-brown, black, and buff color with a barred chest, and is often hunted as game; also, a smaller related bird (Scolopax minor synonym Philohela minor) chiefly of eastern North America with a similar color pattern but having a solid orange buff chest
Birds: Flight and Flocking
ALIGHT: to descend from or as if from the air and come to restALIGHTING: to descend from or as if from the air and come to restALIT: alighted: to descend from or as if from the air and come to rest: land, settleBEAT: to strike the air: flap (as with a bird’s wings)BEVY: a group of animals and especially quailCOVEY: a mature bird or pair of birds with a brood of young, or a small flockFLAP: to beat or pulsate wings or something suggesting wings; to progress by flapping; to flutter ineffectivelyFLAPPING: to beat or pulsate wings or something suggesting wings; to progress by flapping; to flutter ineffectivelyFLEW: to move in or pass through the air with wings (birds, insects, etc.)FLIGHT: (noun) a group of similar beings or objects flying through the air together; a flock (a flight of geese); also, (verb) to rise, settle, or fly in a flock (geese flighting on the marsh); also, to move in or pass through the air with wings (birds, insects, etc.)FLOCK: a group of animals (such as birds or sheep) assembled or herded togetherFLOWN: to move in or pass through the air with wings (birds, insects, etc.)FLYING: to move in or pass through the air with wings (birds, insects, etc.)GAGGLE: a flock, especially: a flock of geese when not in flight KETTLE: a usually large group of raptors (such as hawks or vultures) circling high in the sky on an updraft of warm airKITE: of soaring birds: to hang in the wind with partially-closed wings, often assuming the shape of, and resembling, a kite (the toy, not the bird called a kite)
KITING: of soaring birds: to hang in the wind with partially-closed wings, often assuming the shape of, and resembling, a kite (the toy, not the bird called a kite)LAND: to alight on a surfaceLANDED: to alight on a surfaceLANDING: to alight on a surfaceLIFT: the component of the total aerodynamic force acting on [a bird] that is perpendicular to the relative wind and that for [a bird] constitutes the upward force that opposes the pull of gravity; also, an updraft that can be used to increase altitude (as of a hawk)RAFT: an aggregation of animals (such as waterfowl) resting on the water (a raft of ducks)TROOP: a flock of mammals or birds
VOLANT: flying or capable of flyingWING: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGED: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGING: a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to fly
Birds: Morphology and Plumage specific to birds
BARRING: to mark with straight stripes, bands, or lines that are much longer than they are wide: to mark with bars (a feather barred with blue)BEAK: the bill of a bird, especially: a strong short broad billBEAKED: having a bill or beak, especially: a strong short broad billBEAN: a protuberance on the upper mandible of waterfowlBILL: the jaws of a bird together with their horny coveringBILLED: having a bill especially of a specified kindCAPE: the short feathers covering the shoulders of a fowlCOMB: a fleshy crest on the head of gallinaceous birds [not just domestic birds, as M-W says]CROP: a pouched enlargement of the esophagus of many birds that serves as a receptacle for food and for its preliminary maceration DOWN: a covering of soft fluffy feathersDOWNY: resembling a bird's down, or covered with down, or made of downEPAULET: specially adapted patches of feathers on a bird's shoulders that can be concealed or revealed for any of various displaysFLEDGE: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGED: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGING: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLUFF: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFED: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFILY: covered with or resembling fluff, a covering of soft fluffy feathersFLUFFING: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFS: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFY: covered with or resembling fluff, a covering of soft fluffy feathersFRILL: a ruff of hair or feathers or a bony or cartilaginous projection about the neck of an animalGAPE: the line along which the mandibles of a bird closeGILL: a wattle, a fleshy pendulous process usually about the head or neck (as of a bird)GULLET: esophagus, throatHACKLE: one of the long narrow feathers on the neck or saddle of a bird; also, the neck plumage of the domestic fowlHOCK: a joint of a fowl's leg that corresponds to the hock of a quadrupedHOOD: a color marking or crest on the head of an animal or an expansion of the head that suggests a hoodHOODED: having a hood (hooded crane); having the head conspicuously different in color from the rest of the body (hooded bird); also, having a crest on the head that suggests a hood (hooded seals)KEEL: an anatomical process forming a ridge (as on the sternum of a bird) (the carina)KNEE: the tarsal joint of a birdMANTLE: the upper back of a birdMARK: to furnish with natural marks (a bird’s wings marked with white; leaves marked with spots)MOLT: to shed hair, feathers, shell, horns, or an outer layer periodically; to cast off (an outer covering) periodically; specifically, to throw off (the old cuticle —used of arthropods; also, the act or process of moltingPINION: the terminal section of a bird's wing including the carpus, metacarpus, and phalanges; broadly: the wing; also, feather, quill; also: flight feathers; also, to restrain (a bird) from flight especially by cutting off the pinion of one wing of a bird: having feathersPINIONED: of a bird: having feathers; also, to restrain (a bird) from flight especially by cutting off the pinion of one wingPINIONING: to restrain (a bird) from flight especially by cutting off the pinion of one wingPINTAIL: a bird having elongated central tail feathersPLUME: a feather of a bird: such as a large conspicuous or showy feather, a contour feather, plumage, or a cluster of distinctive feathers POLL: the head; the top or back of the head; napeQUILL: a feather, especially: one of the large stiff feathers of the wing or tail; also, the hollow horny shaft of a featherRUFF: a fringe or frill of long hairs or feathers growing around or on the neck of an animalRUMP: the sacral or dorsal part of the posterior end of a bird (white-rumped sandpiper)TALON: the claw of an animal and especially of a bird of preyTHIGH: the segment of the leg immediately distal to the thigh in a bird or in a quadruped in which the true thigh is obscuredTICKING: ticked marking on a bird or mammal or on individual hairsTOPKNOT: a crest of feathers or tuft of hair on the top of the headTUFT: a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends (a tuft of hair/feathers); also, to form into or grow in tuftsTUFTED: having a tuft or tufts, a small cluster of elongated flexible outgrowths attached or close together at the base and free at the opposite ends (a tuft of hair/feathers); also, to form into or grow in tuftsUNFLEDGED: not feathered: not ready for flightVANE: the web or flat expanded part of a featherWATTLE: a fleshy pendulous process usually about the head or neck (as of a bird)WEBBED: [having or resembling a web,] a tissue or membrane of an animal or plantespecially: that uniting fingers or toes either at their bases (as in humans) or for a greater part of their length (as in many waterbirds); also, [having or resembling a web,] the series of barbs on each side of the shaft of a feather: a vaneWING: one of the movable feathered paired appendages by means of which a bird is able to fly; also: such an appendage (as of an ostrich or penguin) not used for flightWINGED: one of the movable feathered paired appendages by means of which a bird is able to fly; also: such an appendage (as of an ostrich or penguin) not used for flight; having wings; having wings of a specified kind —used in combination (strong-winged, long-winged)
Birds: Reproduction and Young
ADDLE: to muddle eggs so that they will not hatchADDLED: to muddle eggs so that they will not hatchADDLING: to muddle eggs so that they will not hatch
ALBUMEN: the white of an eggBIDDY: a hen, a female chicken especially over a year old; also, a young chickenBROOD: the young of an animal or a family of young, especially: the young (as of a bird or insect) hatched or cared for at one time); also, to sit on or incubate (eggs); to produce by or as if by incubation: hatch; of a bird: to cover (young) with the wingsBROODY: being in a state of readiness to brood eggs that is characterized by cessation of laying and by marked changes in behavior and physiologyCHICK: the young of any birdCLUTCH: a nest of eggs or a brood of chicksCOLT: M-W does not have this definition: a young Sandhill Crane EAGLET: a young eagleFLEDGE: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGED: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGING: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGLING: a young bird just fledged; also, a female bird feeding her fledglingsHACK: to rear (a young hawk) in a state of partial liberty especially prior to the acquisition of flight and hunting capabilitiesHACKED: to rear (a young hawk) in a state of partial liberty especially prior to the acquisition of flight and hunting capabilitiesHATCH: of birds: to incubate eggs: to brood; to sit on (eggs) so as to hatch by the warmth of the body; also, an act or instance of hatching; also, a brood of hatched youngJAKE: a sexually immature male wild turkey under two years old; probably from Jake, nickname for JacobJENNY: a young female turkey, or any female bird, especially a wren; from the name Jenny [Jenny Wren, Dickens, Our Mutual Friend]JUVENILE: a fledged bird not yet in adult plumageLAID: to lay: to bring forth and deposit (an egg)LAYING: to lay: to bring forth and deposit (an egg)NUPTIAL: characteristic of or occurring in the breeding season (nuptial flight, nuptial plumage)OWLET: a small or young owl, any of an order (Strigiformes) of chiefly nocturnal birds of prey with a large head and eyes, short hooked bill, strong talons, and soft fluffy often brown-mottled plumagePOULT: a young fowl, especially: a young turkeyPULLET: a young hen, specifically: a hen of the domestic chicken less than a year oldTEAM: a group of animals: such as a brood, especially of young pigs or ducksTROD: past tense and past participle of tread, to copulate with —used of a male birdUNFLEDGED: not feathered: not ready for flightWHITE: a mass of albuminous material surrounding the yolk of an egg
Birds: Sounds
CACKLE: to make the sharp broken noise or cry characteristic of a hen especially after layingCACKLED: to make the sharp broken noise or cry characteristic of a hen especially after layingCACKLING: to make the sharp broken noise or cry characteristic of a hen especially after layingCALL: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLED: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLING: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCAWED: to utter the harsh raucous natural call of the crow or a similar cryCAWING: to utter the harsh raucous natural call of the crow or a similar cryCHEEP: imitative: to utter faint shrill sounds: to peepCHEEPED: imitative: to utter faint shrill sounds: to peepCHIRP: the characteristic short sharp sound especially of a small bird or insect; also, to make a chirp or a sound resembling a chirpCLANG: a harsh cry of a bird (such as a crane or goose); also, to utter the characteristic harsh cry of a birdCLANGED: a harsh cry of a bird (such as a crane or goose); also, to utter the characteristic harsh cry of a birdCLANGING: a harsh cry of a bird (such as a crane or goose); also, to utter the characteristic harsh cry of a birdCLUCK: the characteristic sound made by a hen especially in calling her chicksCLUCKED: the characteristic sound made by a hen especially in calling her chicksCOOED: to make the low soft cry of a dove or pigeon or a similar soundCOOING: to make the low soft cry of a dove or pigeon or a similar soundCROAK: a hoarse harsh cry or sound; also, to make a deep harsh soundCROAKY: a hoarse harsh cry or sound; also, to make a deep harsh soundCROW: to make the loud shrill sound characteristic of a cockCROW: to make the loud shrill sound characteristic of a cock, or the soundCRYING: to utter a characteristic sound or call (heard the seagulls crying)CUCKOO: the call of the cuckoo; also, not in M-W but in Collins: to utter the call of the cuckoo or an imitation of itCUCKOOED: the call of the cuckoo; also, not in M-W but in Collins: to utter the call of the cuckoo or an imitation of itGOBBLE: to make the natural guttural noise of a male turkeyGOBBLED: to make the natural guttural noise of a male turkeyGOBBLING: to make the natural guttural noise of a male turkeyHONK: the characteristic cry of a goose; also, to make such a sound; also: a similar soundHONKING: the characteristic cry of a goose; also, to make such a sound; also: a similar soundHOOT: to make the natural throat noise of an owl or a similar cry; also, a sound of hooting, especially: the cry of an owlHOOTED: to make the natural throat noise of an owl or a similar cry; also, a sound of hooting, especially: the cry of an owlHOOTING: to make the natural throat noise of an owl or a similar cry; also, a sound of hooting, especially: the cry of an owlMOURN: to murmur mournfully —used especially of dovesMOURNING: to murmur mournfully —used especially of dovesNOTE: a call or sound, especially: the musical call of a birdPEEP: a feeble shrill sound: a cheep; also, to utter a feeble shrill sound as of a bird newly hatched: to cheepPEEPED: a feeble shrill sound: a cheep; also, to utter a feeble shrill sound as of a bird newly hatched: to cheepPEEPING: a feeble shrill sound: a cheep; also, to utter a feeble shrill sound as of a bird newly hatched: to cheepROLL: to trill —used of a songbirdTWEET: a chirping note; also, to make a chirping soundTWEETED: a chirping note; also, to make a chirping soundWHOOP: the loud cry or call of an animal (such as an owl, whooping crane, or gibbon) that resembles the sound of the word whoop; also, to utter the cry or call of an animal (such as an owl or gibbon)WHOOPING: the loud cry or call of an animal (such as an owl, whooping crane, or gibbon) that resembles the sound of the word whoop; also, to utter the cry or call of an animal (such as an owl or gibbon)
Birds: Words about Birds
AVIAN: of, relating to, or derived from birdsAVIARY: a place for keeping birds confinedBAND: the attachment of a small, individually numbered metal or plastic tag to the leg or wing of a wild birdBANDED: the attachment of a small, individually numbered metal or plastic tag to the leg or wing of a wild birdBANDING: the attachment of a small, individually numbered metal or plastic tag to the leg or wing of a wild birdBIRD: any of a class (Aves) of warm-blooded vertebrates distinguished by having the body more or less completely covered with feathers and the forelimbs modified as wingsBIRDBATH: a usually ornamental basin set up for birds to bathe inHAGGARD: of a hawk: not tamed; also, an adult hawk caught wildHAWK: to hunt birds by means of a trained hawk: to practice falconryHOOD: in falconry: a covering for a hawk's head and eye
Fish
ANCHOVY: any of a family (Engraulidae) of small fishes resembling herrings that includes several (such as Engraulis encrasicholus) that are important food fishes …ANGEL: the angelfish; any of several laterally compressed brightly colored bony fishes (family Pomacanthidae) of warm seasBIGEYE: any of several small widely distributed reddish to silvery bony fishes (genus Priacanthus of the family Priacanthidae) of tropical seasBLITZ: an occurrence in which large numbers of fish gather to chase and feed on prey or baitBLUE : bluefish, an active food and game marine fish (Pomatomus saltatrix) that is bluish above with silvery sides, or any of various dark or bluish fishes (such as the pollack)BLUEFIN: M-W’s entry is for bluefin tuna, a very large tuna (Thunnus thynnus) that is an important food and game fish; called also bluefinBONITO: any of several swift-swimming scombroid fishes (genus Sarda) that are typically dark blue to bluish-green with dark stripes and a silvery belly, that are intermediate in size between the related mackerel and tuna, and that are valued as food and sport fishes; bluefin tunaBROWN: the brown trout, a speckled European trout (Salmo trutta) widely introduced as a game fishBUFFALO: any of several suckers (genus Ictiobus) found mostly in the Mississippi River valley; called also buffalo fishBURBOT: a Holarctic freshwater bony fish (Lota lota) of the cod family having barbels on the nose and chinCARP: a large variable Asian soft-finned freshwater cyprinid fish (Cyprinus carpio) of sluggish waters that is often raised for food and has been widely introduced into U.S. waters; also: any of various related cyprinid fishes (such as the grass carp); also, a fish (such as the European sea bream) resembling a carpCHAR: any of a genus (Salvelinus) of small-scaled trouts with light-colored spotsCHUB: any of numerous freshwater cyprinid fishes (as of the genera Gila and Nocomis); also, any of several marine or freshwater fishes (such as the tautog) that are not cyprinidsCHUM: chum salmon, variants or less commonly chum: a metallic bluish green salmon (Oncorhynchus keta) of the northern Pacific Ocean and Arctic Ocean that may reach a length of about 3.5 feet (1 meter) but is typically smallerCICHLID: any of a family (Cichlidae) of mostly tropical spiny-finned usually freshwater fishes including several kept in tropical aquariumsCOHO: a rather small Pacific salmon (Oncorhynchus kisutch) that has light-colored flesh and is native to both coasts of the North Pacific and is stocked in the Great LakesDACE*: a small freshwater European cyprinid fish (Leuciscus leuciscus), or any of various small North American freshwater cyprinid fishesDOLPHIN: synonym for dolphinfish, either of two colorful, iridescent, saltwater fish (Coryphaena equiselis and C. hippurus of the family Coryphaenidae) that are widely distributed in tropical and temperate seas and have a long laterally compressed body and a deeply forked tail fin. Note: The common dolphinfish (Coryphaena hippurus) is valued as a food fish and is often called mahi-mahi.DORADO: mahi-mahi, the flesh of a dolphinfish (Coryphaena hippurus) used for food; also: the fishDRUM: any of various chiefly marine bony fishes (family Sciaenidae) that make a drumming or croaking noise using their air bladder and associated musclesEELY: like an eel, any of numerous voracious elongate snakelike bony fishes (order Anguilliformes) that have a smooth slimy skin, lack pelvic fins, and have the median fins confluent around the tail
ELVER: a young eel, specifically: a small immature catadromous eel chiefly of fresh and brackish waterFUGU: any of various very poisonous puffer fishes (family Tetraodontidae) that contain tetrodotoxin and that are used as food in Japan after the toxin-containing parts are removedGILL: an organ (as of a fish) for obtaining oxygen from waterGOBY: any of numerous spiny-finned fishes (family Gobiidae) that usually have the pelvic fins united to form a ventral sucking diskGRUNT: [from the noise it makes when taken from the water]: any of a family (Haemulidae synonym Pomadasyidae) of chiefly tropical marine bony fishesGUPPY: a small bony fish (Poecilia reticulata of the family Poeciliidae) especially of Barbados, Trinidad, and Venezuela that is a live-bearer and is often kept as an aquarium fish, named for R. J. L. Guppy †1916 Trinidadian naturalistHAKE: any of several marine food fishes (as of the genera Merluccius and Urophycis) related to the Atlantic codHALIBUT: any of several marine flatfishes (especially Hippoglossus hippoglossus of the Atlantic and H. stenolepis of the Pacific) that are widely used for food and include some of the largest bony fishesHAMACHI: NOAD: The young of the Japanese amberjack or yellowtail, which is fished and bred in Japan as a food fish.HIND: any of various spotted groupers (especially genus Epinephelus)HOUND: a dogfishJACK: any of several fishes, especially: any of various carangidsKING: king salmon, a chinook salmon, a large, usually red-fleshed, commercially important salmon (Oncorhynchus tshawytscha) of the northern Pacific Ocean that is typically bluish-green above with silvery sides, has a dark mouth with black gums, and attains an average weight of about 30 to 40 pounds (13.5 to 18 kilograms) but may sometimes exceed 120 pounds (54 kilograms); called also black salmon, king salmonLOACH: any of a family (Cobitidae) of small Old World freshwater fishes related to the carpsMAHIMAHI: M-W indicates variant of mahi-mahi (also mahi mahi), the dolphinfish (Coryphaena hippurus), or its flesh used for foodMAKO: mako shark, called also mako, either of two relatively slender mackerel sharks (Isurus paucus and I. oxyrinchus) that are dark blue above and white below with long pointed snouts and that are notable sport fishMANTA: the manta ray, a ray (Manta birostris) that averages 22 feet (6.7 meters) in width with a weight reaching 3000 pounds (1361 kilograms) [American Spanish, from Spanish; from its shape like a cloak]MARLIN: any of several large marine billfishes (genera Makaira and Kajikia) that are notable sport fishesMINNOW: a small cyprinid, killifish, or topminnow; also, any of various small fish that are less than a designated size and are not game fishMOLLY: any of various small, often brightly colored tropical fish (genus Poecilia) that are live-bearers found in fresh, brackish, or salt water and include several that are highly valued as aquarium fishes; by shortening from New Latin Mollienisia, former genus name, from Comte François N. Mollien †1850 French statesmanMORAY: M-W: moray eel, “called also moray” any of numerous often brightly colored eels (family Muraenidae) that have sharp teeth capable of inflicting a severe bite, that occur in warm seas, and that include a chiefly Mediterranean eel (Muraena helena) sometimes used for food; called also morayMULLET: any of a family (Mugilidae) of chiefly marine bony fishes with an elongate rather stout bodyOPAH*: a large elliptical laterally compressed marine bony fish (Lampris guttatus of the family Lampridae) with brilliant colorsPIKE: a large elongate long-snouted freshwater bony fish (Esox lucius) valued for food and sport and widely distributed in cooler parts of the northern hemisphere; called also northern, northern pike; also, any of various fishes (family Esocidae) related to the pike: such as muskellunge, pickerel, or any of various fishes resembling the pike in appearance or habitsPIRANHA: any of various usually small South American characin fishes (genera Serrasalmus and Pygocentrus) that have very sharp teeth, often appear in schools, and include some that may attack and inflict dangerous wounds upon humans and large animals; called also caribePOLLARD*: the European chub (Squalius cephalus), a freshwater fish [Wikipedia]
POLLOCK: variant of pollack, a commercially important North Atlantic food fish (Pollachius virens) related to and resembling the cods but darker; also, a commercially important northern Pacific food fish (Gadus chalcogrammus synonym Theragra chalcogramma) of the cod family that closely resembles the pollack, called also walleye pollackPOMPANO: a carangid food fish (Trachinotus carolinus) of the western Atlantic and Gulf of Mexico; broadly: any of several related fishes; also, small bluish or greenish butterfish (Peprilus simillimus) of the Pacific coast of North AmericaPOUT: any of several large-headed fishes (such as a bullhead or eelpout)RAINBOW: the rainbow trout, a large stout-bodied salmonid fish (Oncorhynchus mykiss synonym Salmo gairdneri) of western North America that is related to the Pacific salmon and is typically greenish above and white on the belly with a pink, red, or lavender stripe along each side of the body and with profuse black dotsRATTAIL: a grenadier, any of various deep-sea fishes (family Macrouridae) that are related to the cods and have an elongated tapering body and compressed pointed tailROACH: a silver-green European freshwater cyprinid fish (Rutilus rutilus)also: any of various related fishes (such as some shiners); also, any of several American freshwater sunfishes (family Centrarchidae)roachRUFF: a small freshwater European perch (Gynocephalus cernua synonym Acerina cernua)RUNNING: of fish: to migrate or move in considerable numbers, especially: to move up or down a river to spawnTAILFIN*: M-W has tail fin, the terminal fin of a fish or cetacean; Collins has tailfin, in British English: the fin situated at the tail of a fishTANG: any of various surgeonfishesTILAPIA: any of numerous chiefly African freshwater cichlid fishes (genera Oreochromis, Tilapia, and Sarotherodon) often raised for foodTOPE: a small slender cosmopolitan shark (Galeorhinus galeus) valued for its flesh, fins, and oil-rich liverTORO: a jack crevalle, a carangid fish (Caranx hippos) that is an important food fish especially along the west coast of Florida; also, a cowfish (Lactophryes quadricornis), [or] any of various small bright-colored bony fishes (family Ostraciidae) with hornlike projections over the eyesTROUT: any of various salmonid food and sport fishes that are mostly smaller than the typical salmons and are anadromous or restricted to cool clear fresh water; also, any of various Old or New World fishes (genera Salmo, Salvelinus, and Oncorhynchus); also, char, any of a genus (Salvelinus) of small-scaled trouts with light-colored spots; also, any of various fishes (such as the largemouth bass) held to resemble the true troutsTUNA: any of various large vigorous scombroid fishes (as of the genera Euthynnus, Katsuwonus, and especially Thunnus) that are usually dark above and silvery below and include many that are valued as food or sport fishesTURBOT: a large European flatfish (Scophthalmus maximus synonym Psetta maxima) that is a popular food fish and has a brownish upper surface marked with scattered tubercles and a white undersurface; also, a flatfish (such as Reinhardtius hippoglossoides) resembling the turbotWAHOO: a large vigorous mackerel (Acanthocybium solandri) that is common in warm seas and esteemed as a food and sport fishWALLEYE: a large vigorous North American freshwater food and sport fish (Sander vitreus synonym Stizostedion vitreum) that has large opaque eyes and is related to the perches but resembles the true pike; called also walleyed pikeWHITING: any of various marine food fishes: such as a common European fish (Merlangius merlangus) of the cod family, or silver hake, a common hake (Merluccius bilinearis) of the northern Atlantic coast of the U.S. that is an important food fish
Insects, Arachnids, etc.
ADMIRAL: any of several brightly colored nymphalid butterfliesANTENNA: one of a pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansANTENNAE: the pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansANTHILL: a mound of debris thrown up by ants or termites in digging their nestAPHID: any of numerous very small soft-bodied homopterous insects (superfamily Aphidoidea) that suck the juices of plantsAPIAN: of or relating to beesAPIARIAN*: of or relating to beekeeping or beesAPIARY: a place where bees are kept, especially: a collection of hives or colonies of bees kept for their honeyAPOLLO*: M-W does not mention, and NOAD does not capitalize apollo, A large butterfly which has creamy-white wings marked with black and red spots, found chiefly on the mountains of mainland Europe.BEEHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of beesBEEKEEPING: raising and caring for beesBEELINE: from the belief that nectar-laden bees return to their hives in a direct lineBEETLE: any of an order (Coleoptera) of insects having four wings of which the outer pair are modified into stiff elytra that protect the inner pair when at restBLEW: of insects: to deposit eggs or larvae on or inBLOW: of insects: to deposit eggs or larvae on or inBLOWING: of insects: to deposit eggs or larvae on or inBLOWN: of insects: to deposit eggs or larvae on or inBLUE: any of numerous small chiefly blue butterflies (family Lycaenidae)BLUEBOTTLE: any of several blowflies (genus Calliphora) that have the abdomen or the whole body iridescent blue in color and that make a loud buzzing noise in flightBROOD: the young (as of an insect) hatched or cared for at one timeBUGGY: infested with bugsBUMBLEBEE: any of numerous large robust hairy social bees (genus Bombus)CELL: a membranous area bounded by veins in the wing of an insect; also, one of the compartments of a honeycombCENTIPEDE: any of a class (Chilopoda) of long flattened many-segmented predaceous arthropods with each segment bearing one pair of legs of which the foremost pair is modified into poison fangsCHIRP: the characteristic short sharp sound especially of a small bird or insect; also, to make a chirp or a sound resembling a chirpCHITIN: a horny polysaccharide (C8H13NO5)n that forms part of the hard outer integument especially of insects, arachnids, and crustaceansCICADA: any of a family (Cicadidae) of homopterous insects which have a stout body, wide blunt head, and large transparent wings and the males of which produce a loud buzzing noise usually by stridulationCOCOON: an envelope often largely of silk which an insect larva forms about itself and in which it passes the pupa stageCOCOONED: an envelope often largely of silk which an insect larva forms about itself and in which it passes the pupa stageCOCOONING: an envelope often largely of silk which an insect larva forms about itself and in which it passes the pupa stageCOMB: a honeycomb: a mass of hexagonal wax cells built by honeybees in their nest to contain their brood and stores of honeyCOMMA: any of several nymphalid butterflies (genus Polygonia) with a silvery comma-shaped mark on the underside of the hind wingsCOMPLETE: of insect metamorphosis: characterized by the occurrence of a pupal stage between the motile immature stages and the adultCRAB: crabs plural: infestation with crab lice: crab louse a sucking louse (Pthirus pubis) infesting the pubic region of the human bodyCROP: an enlargement of the digestive tract of an animal other than a bird (such as an insect)CUTICLE: an external envelope (as of an insect) secreted usually by epidermal cellsFANG: one of the chelicerae of a spider at the tip of which a poison gland opensFANGED: one of the chelicerae of a spider at the tip of which a poison gland opensFLAGELLA: plural of flagellum, any of various elongated filiform appendages of plants or animals: such as the slender distal part of an antenna; also, a long tapering process that projects singly or in groups from a cell and is the primary organ of motion of many microorganismsFLEA: any of an order (Siphonaptera) of small wingless bloodsucking insects that have a hard laterally compressed body and legs adapted to leaping and that feed on warm-blooded animalsFLEW: to move in or pass through the air with wings (birds, insects, etc.)FLIGHT: to move in or pass through the air with wings (birds, insects, etc.)FLOWN: to move in or pass through the air with wings (birds, insects, etc.)FLYING: to move in or pass through the air with wings (birds, insects, etc.)FORMIC: M-W has only the open compounds formic acid (a colorless pungent fuming vesicant liquid acid CH2O2 found especially in ants and in many plants and used chiefly in dyeing and finishing textiles) and formic aldehyde (formaldehyde)GNAT: any of various small usually biting dipteran fliesGRUB: a soft thick wormlike larva of an insect (such as a beetle)GRUBBY: infested with fly maggotsHATCH: of insects: to emerge from an egg, chrysalis, or pupa; an act or instance of hatching; also, a brood of hatched youngHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of bees; also, of bees: to enter and take possession of a hive; also, to collect into a hive; also, to store up in or as if in a hiveHIVED: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of bees; also, of bees: to enter and take possession of a hive; also, to collect into a hive; also, to store up in or as if in a hiveHIVING: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of bees; also, of bees: to enter and take possession of a hive; also, to collect into a hive; also, to store up in or as if in a hiveHONEY: a sweet viscid material elaborated out of the nectar of flowers in the honey sac of various bees; also, a sweet fluid resembling honey that is collected or elaborated by various insectsHONEYBEE: a honey-producing bee (genus Apis of the family Apidae), especially: a European bee (A. mellifera) introduced worldwide and kept in hives for the honey it producesHONEYDEW: a saccharine deposit secreted on the leaves of plants usually by aphids or scale insects or sometimes by a fungusKNEE: the joint between the femur and tibia of an insectLABIA: plural of labium, a lower mouthpart of an insect that is formed by the second pair of maxillae united in the middle lineLABIAL: of, relating to, or situated near the lips or labia, a lower mouthpart of an insect that is formed by the second pair of maxillae united in the middle lineLADYBUG: any of numerous small nearly hemispherical often brightly colored often spotted beetles (family Coccinellidae) of temperate and tropical regions that usually feed both as larvae and adults on other insects (such as aphids); called also lady beetle, ladybird, ladybird beetleLARVA: the immature, wingless, and often wormlike feeding form that hatches from the egg of many insects, alters chiefly in size while passing through several molts, and is finally transformed into a pupa or chrysalis from which the adult emergesLARVAL: the immature, wingless, and often wormlike feeding form that hatches from the egg of many insects, alters chiefly in size while passing through several molts, and is finally transformed into a pupa or chrysalis from which the adult emergesLICE: plural of louse, any of various small wingless usually flattened insects (orders Anoplura and Mallophaga) parasitic on warm-blooded animals; or a small usually sluggish arthropod (such as a biting louse) that lives on other animals or on plants and sucks their blood or juices; or any of several small arthropods (such as a book louse) that are not parasitic. (Note that the plural of louse, meaning a contemptible person, is louses.)MAGGOT: a soft-bodied legless grub that is the larva of a dipterous insect (such as the housefly)MANNA: a product excreted by a scale insect (Trabutina mannipara) feeding on the tamarisk that is similar to manna, the sweetish dried exudate of a Eurasian ash (especially Fraxinus ornus) that contains mannitol and has been used as a laxative and demulcentMAXILLA: one of the first or second pair of mouthparts posterior to the mandibles in many arthropods (such as insects or crustaceans)MAYFLY: any of an order (Ephemeroptera) of insects with an aquatic nymph and a short-lived, fragile adult lacking mouthparts and having membranous, heavily veined wings and two or three long, threadlike tailsMIDGE: a tiny dipteran fly (such as a chironomid)MITE: any of numerous small acarid arachnids that often infest animals, plants, and stored foods and include important disease vectorsMONARCH: the monarch butterflyMOTH: any of various usually nocturnal lepidopteran insects with antennae that are often feathery, with a stouter body, duller coloring, and proportionately smaller wings than the butterflies, and with larvae that are plant-eating caterpillarsMOTHY: related to moths, any of various usually nocturnal lepidopteran insects with antennae that are often feathery, with a stouter body, duller coloring, and proportionately smaller wings than the butterflies, and with larvae that are plant-eating caterpillarsNAIAD: an aquatic insect nymph (as of a mayfly, dragonfly, damselfly, or stone fly)
NERVE: vein: any of the thickened cuticular ribs that serve to stiffen the wings of an insectPALP: the palpus, a segmented usually tactile or gustatory process on an arthropod mouthpartPOLLEN: a dusty bloom on the body of an insectPUPA: an intermediate usually quiescent stage of a metamorphic insect (such as a bee, moth, or beetle) that occurs between the larva and the imago, is usually enclosed in a cocoon or protective covering, and undergoes internal changes by which larval structures are replaced by those typical of the imagoPUPAE: plural or pupa, an intermediate usually quiescent stage of a metamorphic insect (such as a bee, moth, or beetle) that occurs between the larva and the imago, is usually enclosed in a cocoon or protective covering, and undergoes internal changes by which larval structures are replaced by those typical of the imagoPUPAL: of or having to do with a pupa, an intermediate usually quiescent stage of a metamorphic insect (such as a bee, moth, or beetle) that occurs between the larva and the imago, is usually enclosed in a cocoon or protective covering, and undergoes internal changes by which larval structures are replaced by those typical of the imagoPUPATE: to become a pupa, an intermediate usually quiescent stage of a metamorphic insect (such as a bee, moth, or beetle) that occurs between the larva and the imago, is usually enclosed in a cocoon or protective covering, and undergoes internal changes by which larval structures are replaced by those typical of the imago; also, to pass through a pupal stageQUEEN: the fertile fully developed female of social bees, wasps, ants, and termites whose function is to lay eggsRADII: plural of radius, the third and usually largest vein of an insect's wingROACH: a cockroach, any of an order or suborder (Blattodea synonym Blattaria) of chiefly nocturnal insects including some that are domestic pestsTANNING: a natural darkening and hardening of the cuticle of an insect immediately after moltingTARANTULA: any of various large, typically ground-dwelling, hairy, mygalomorph spiders (family Theraphosidae) of warm regions that possess venomous fangs used to subdue and kill prey (such as insects, centipedes, frogs, and mice) caught by ambush or chase and that construct silk-lined burrows but do not build webs to trap food; also, a European wolf spider (Lycosa tarantula) formerly held to be the cause of tarantism; from Old Italian tarantola, from Taranto, city and port on the Gulf of Taranto (an inlet of the Ionian Sea) in southeastern ItalyTENT: the web of a tent caterpillar, any of several social caterpillars (genus Malacosoma and especially M. americanum of the family Lasiocampidae) that form large silken webs on trees and may cause serious defoliationTHIGH: the femur of an insectTHORACIC: the middle of the three chief divisions of the body of an insect; also, the corresponding part of a crustacean or an arachnidTIBIA: the fourth joint of the leg of an insect between the femur and tarsusTIBIAE: plural of tibia, the fourth joint of the leg of an insect between the femur and tarsusTIBIAL: related to the tibia, the fourth joint of the leg of an insect between the femur and tarsusTICK: any of a superfamily (Ixodoidea) of bloodsucking acarid arachnids that are larger than the related mites, attach themselves to warm-blooded vertebrates to feed, and include important vectors of infectious diseases; also, any of various usually wingless parasitic dipteran fliesVEIN: any of the thickened cuticular ribs that serve to stiffen the wings of an insectVEINED: patterned with or as if with veins: having venation, an arrangement or system of veins (as in the tissue of a leaf or the wing of an insect): streaked VEINING: a pattern of veins: venation, an arrangement or system of veins (as in the tissue of a leaf or the wing of an insect) WEAVE: to spin, to form a thread by extruding a viscous rapidly hardening fluid —used especially of a spider or insect (weaves a web in the corner)WEAVING: to spin, to form a thread by extruding a viscous rapidly hardening fluid —used especially of a spider or insect (weaves a web in the corner)WEBBED: [having or resembling a web,] cobweb, a spiderweb, or a network of silken thread spun especially by the larvae of various insects (such as a tent caterpillar) and usually serving as a nest or shelterWHITE: any of numerous butterflies (subfamily Pierinae of the family Pieridae) that usually have the ground color of the wings white and are related to the sulphur butterfliesWILT: a viral disease of caterpillarsWING: one of the movable membranous paired appendages by means of which an insect is able to fly; also, a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGED: one of the movable membranous paired appendages by means of which an insect is able to fly; also, a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWINGING: one of the movable membranous paired appendages by means of which an insect is able to fly; also, a means of flight or rapid progress; also, the act or manner of flying: flight (take wing); also, to enable to fly or move swiftly; to traverse with or as if with wings; to effect or achieve by flying; to go with or as if with wings: to flyWOLF: the maggot of a warble fly, any of various beelike flies (family Oestridae) having larvae that are internal parasites of mammals (such as cattle)
Invertebrates NOC
ANEMONE: usually “sea anemone”: any of numerous usually solitary anthozoan polyps (order Actiniaria) whose form, bright and varied colors, and cluster of tentacles superficially resemble a flowerARACHNID: any of a class (Arachnida) of arthropods comprising chiefly terrestrial invertebrates, including the spiders, scorpions, mites, and ticks, and having a segmented body divided into two regions of which the anterior bears four pairs of legs but no antennaeARTHROPOD: any of a phylum (Arthropoda) of invertebrate animals (such as insects, arachnids, and crustaceans) that have a segmented body and jointed appendages, a usually chitinous exoskeleton molted at intervals, and a dorsal anterior brain connected to a ventral chain of gangliaBELL: a bell-shaped organ or part (such as the dewlap of a moose), or the bell- or saucer-shaped, largely gelatinous structure that forms the main part of the body of most jellyfishCOOTIE: a body louse or head louseCORAL: the calcareous or horny skeletal deposit produced by anthozoan or rarely hydrozoan polyps, especially: a richly red precious coral secreted by a gorgonian (genus Corallium); also, a polyp or polyp colony together with its membranes and skeleton; also, a piece of coral and especially of red coralHYDRA: not capitalized: any of numerous small tubular freshwater hydrozoan polyps (Hydra and related genera) having at one end a mouth surrounded by tentaclesLABIA: plural of labium, a liplike part of various invertebratesLABIAL: of, relating to, or situated near the lips or labia, a liplike part of various invertebratesPLANARIA: any of a genus (Planaria) of 2-eyed planarian worms; broadly: planarianPLANARIAN: a triclad, especially: any of various dark-colored freshwater triclad flatworms (family Planariidae) with two eyespots and a triangular headPOLYP: the sessile form of cnidarian (such as a coral or sea anemone) typically having a hollow cylindrical body closed and attached at one end and opening at the other by a central mouth surrounded by tentacles armed with nematocystsWORM: an earthworm; broadly: an annelid worm, any of a phylum (Annelida) of usually elongated segmented coelomate invertebrates (such as earthworms and leeches); also, any of numerous relatively small elongated usually naked and soft-bodied animals (such as a grub, pinworm, tapeworm, shipworm, or slowworm)
Mammals: Antelopes
BONGO: an African antelope (Tragelaphus eurycerus) that is chestnut red with narrow white vertical stripes and is found in forests from Sierra Leone to KenyaELAND: either of two large African antelopes (Taurotragus oryx synonym Tragelaphus oryx and Taurotragus derbianus synonym Tragelaphus derbianus) bovine in form with short spirally twisted horns in both sexesGAZELLE: any of numerous small to medium graceful and swift African and Asian antelopes (Gazella and related genera)IMPALA: large brownish antelope (Aepyceros melampus) of southeastern Africa that in the male has slender curved horns with ridgesKIDDED: to bring forth young, used of a goat or an antelopeKIDDING: to bring forth young, used of a goat or an antelopeKUDU: a large grayish brown African antelope (Tragelaphus strepsiceros) with large annulated spirally twisted horns; also: a related antelope (T. imberbis)LAMB: the young of various animals (such as the smaller antelopes) other than sheep; also, to bring forth (give birth to) a lambORIBI*: any of several small antelopes (genus Ourebia) of southern and eastern Africa that are tawny yellow above and white below and have straight annulated horns about five inches long
Mammals: Bovine
BEEF: an ox, cow, or bull in a full-grown or nearly full-grown state; especially: a steer or cow fattened for foodBELLOW: to make the loud deep hollow sound characteristic of a bullBELLOWED: to make the loud deep hollow sound characteristic of a bullBLAT: alteration of bleat, to cry like a calf or sheep: to bleat; also, the sound made by blattingBOSS: a cow, a calfBOVID: any of a family (Bovidae) of ruminants that have hollow unbranched permanently attached horns present in usually both sexes and that include antelopes, oxen, sheep, and goatsBUFF: any of several wild bovids: such as the water buffalo, the cape buffalo, or the bison, especially the North American bisonBUFFALO: any of several wild bovids: such as water buffalo, cape buffalo, or bison, especially: a large North American bison (Bison bison) that has a dense coat of dark brown fur with a shaggy mane on the head and lower neck, short hollow horns, and heavy forequarters with a large muscular hump over the shoulders and that formerly was abundant in North America but is now reduced to small populations of plains and prairies chiefly of the central U.S. and Canada: American bisonBULL: a male bovine, especially: an adult uncastrated male domestic bovine; also, of or relating to a bull; also, suggestive of a bull; also, male (a bull calf)BULLOCK: a young bull; a castrated bull: a steerCALF: the young of the domestic cow; also: that of a closely related mammal (such as a bison); or the young of various large animals (such as the elephant or whale)CALVE: to give birth to a calfCATTLE: domesticated quadrupeds held as property or raised for use; specifically: bovine animals on a farm or ranchDOGIE: chiefly Western US: a motherless calf in a range herdHORN: one of the permanent paired hollow sheaths of keratin usually present in both sexes of cattle and their relatives that function chiefly for defense and arise from a bony core anchored to the skullLONGHORN: any of the long-horned cattle of Spanish derivation formerly common in the southwestern U.S.; the Texas longhornNEAT: the common domestic bovine (Bos taurus) plural: neat or neatsOXEN: plural of ox, a domestic bovine mammal (Bos taurus); broadly: a bovine mammal, especially an adult castrated male domestic ox (a team of oxen)OXLIKE: resembling, suggestive of, or having the characteristics of an ox
POLLARD*: a hornless goat, deer, ox, etc. [Collins]TORO: chiefly Southwest [US]: a bullVEAL: a calf, the young of the domestic cow, especially, a vealer, a calf grown for or suitable for veal
YAKS: a large long-haired wild or domesticated ox (Bos grunniens synonym Poephagus grunniens) of Tibet and adjacent elevated parts of central Asia
Mammals: Canine
BARK: to make the characteristic short loud cry of a dog; to make a noise resembling a barkBAYED: to bark with prolonged tonesBAYING: to bark with prolonged tonesBEAGLE: any of a breed of small short-legged smooth-coated often black, white, and tan houndsBITCH*: a female dogBLOODHOUND: any of a breed of large powerful hounds of European origin remarkable for acuteness of smellBORZOI: any of a breed of large dogs developed in Russia especially for pursuing wolves that have a long silky usually white coat with darker markingsBOWWOW: the bark of a dog, or a dog
BULL: short for bulldog, any of a breed of compact muscular short-haired dogs having widely separated forelegs and an undershot lower jaw that were developed in England to fight bullsCANID: any of a family (Canidae) of carnivorous animals that includes the wolves, jackals, foxes, coyote, and the domestic dogCANINE: of or resembling that of a dog; of or relating to dogs or to the family (Canidae) including the canidsCHIHUAHUA: M-W capitalizes Chihuahua: any of a breed of very small roundheaded dogs that occur in short-coated and long-coated varieties, from Chihuahua, Mexico. NOAD does not capitalize.CHOW: often Chow Chow: any of a breed of heavy-coated sturdy muscular dogs of Chinese origin having a broad head and muzzle, a distinctive blue-black tongue and black-lined mouth, and either a long dense coat with a full ruff or a short smooth coat; called also chowCOCKAPOO: a dog that is a cross between a cocker spaniel and a poodle; alteration of cocker (spaniel) + poodleCOLLIE: any of a breed of large dogs developed in Scotland that occur in rough-coated and smooth-coated varieties and have erect ears and a long muzzleCORGI: short for Welsh corgi, a short-legged long-backed dog with foxy head of either of two breeds of Welsh originCOYOTE: a buff-gray to reddish-gray swift carnivorous mammal (Canis latrans) of North America that is closely related to but smaller than the wolfDALMATIAN: often capitalized:: any of a breed of medium-sized dogs having a white short-haired coat with many black or brown spots; from the supposed origin of the breed in DalmatiaDINGO: a wild dog (Canis dingo) of Australia having a tan or reddish coat that is often considered a subspecies (C. familiaris dingo) of the domestic dogDOGFIGHT: a fight between dogsDOGGIE: M-W: variant of doggy, a usually small dog; also, resembling or suggestive of a dog (a doggy odor); also, concerned with or fond of dogsDOGGO: an affectionate term for a dog (Australian origin?)DOGGY: M-W: or doggie, a usually small dog; also, resembling or suggestive of a dog (a doggy odor); concerned with or fond of dogsDOGTROT: a quick easy gait suggesting that of a dogFALL: long hair overhanging the face of dogs of some breedsFALLS: long hair overhanging the face of dogs of some breedsFLAG: the tail of some dogs (such as a setter or hound); also: the long hair fringing a dog's tailGAIT: a sequence of foot movements (such as a walk, trot, pace, or canter) by which a horse or a dog moves forward; also, to train (a horse or a dog) to use a particular gait or set of gaits; also, to lead (a show dog) before a judge to display carriage and movementHACKLE: erectile hairs along the neck and back especially of a dogHOUND: a dog, especially any of numerous hunting breeds including both scent hounds (such as the bloodhound and beagle) and sight hounds (such as the greyhound and Afghan hound)HYENA: any of several large strong nocturnal carnivorous Old World mammals (family Hyaenidae) that usually feed as scavengersJACKAL: any of several small omnivorous canids (such as Canis aureus) of Africa and Asia having large ears, long legs, and bushy tailsKELPIE: any of a breed of energetic working dogs developed in Australia from British sheepdogsKENNEL: a pack of dogsLOBO: the gray wolf, a large, broad-headed, wide-muzzled wolf (Canis lupus) that has a dense, heavy coat of usually light brown or brownish gray interspersed with black above and yellowish white below and that was formerly widely distributed throughout North America and Eurasia but is now greatly restricted to the more northerly parts of its rangeLOBOS: the gray wolf, a large, broad-headed, wide-muzzled wolf (Canis lupus) that has a dense, heavy coat of usually light brown or brownish gray interspersed with black above and yellowish white below and that was formerly widely distributed throughout North America and Eurasia but is now greatly restricted to the more northerly parts of its rangeLUPINE: wolfishMALAMUTE: a sled dog of northern North AmericaMUTT: a mongrel dog: a curPAPILLON: any of a European breed of small slender toy spaniels having large erect heavily fringed earsPEKE: often capitalized: Peke, Pekingese, any of a Chinese breed of small short-legged dogs with a broad flat face and a profuse long soft coat; from Peking, former Anglicized name of BeijingPOOCH: informal: a dogPULI: any of a breed of medium-sized agile Hungarian sheepdogs with a thick woolly coat hanging in long thin cordsPUPPY: a young domestic dog, specifically: one less than a year oldPUPPYLIKE: a young domestic dog, specifically: one less than a year oldTRICOLOR: of a dog: having a coat of black, tan, and whiteVULPINE: of, relating to, or resembling a foxWHELP: any of the young of various carnivorous mammals and especially of the dog; also, to give birth to —used of various carnivores and especially the dog; to bring forth youngWOLF: any of several large predatory canids (genus Canis) that are active mostly at night, live and hunt in packs, and resemble the related dogs, especially: the gray wolf, a large, broad-headed, wide-muzzled wolf (Canis lupus) that has a dense, heavy coat of usually light brown or brownish gray interspersed with black above and yellowish white below and that was formerly widely distributed throughout North America and Eurasia but is now greatly restricted to the more northerly parts of its range; called also timber wolfWOOF: a low gruff sound typically produced by a dog; also, to make the low gruff sound typically produced by a dogWOOFED: a low gruff sound typically produced by a dog; also, to make the low gruff sound typically produced by a dogWOOFING: a low gruff sound typically produced by a dog; also, to make the low gruff sound typically produced by a dogYAPPED: to bark snappishly: to yelpYAPPY: [of a dog] given to yapping, to bark snappishly: to yelpYAPPY: resembling or characteristic of a yap, a quick sharp bark: a yelpYELP: a sharp shrill bark or cry (as of a dog); a squeal; to utter a sharp quick shrill cry (dogs yelp); to utter with a yelpYELPED: a sharp shrill bark or cry (as of a dog); a squeal; to utter a sharp quick shrill cry (dogs yelp); to utter with a yelpYIPPING: to bark sharply, quickly, and often continuously
Mammals: Caprine (goats)
ANGORA: the hair of the Angora rabbit or Angora goat, or a yarn of Angora rabbit hair used especially for knitting. (In the names of animals -- Angora cat, Angora rabbit, Angora goat – the adjective is proper.) From Ankara (historically known as Angora), in present-day Turkey.BILLY: a billy goat, a male goat; from the name BillyBLAT: alteration of bleat, to cry like a calf or sheep: to bleat; also, the sound made by blattingBLEAT: or blat, the cry of a sheep or goat; also, to make the natural cry of a sheep or goatFAWN: a young goat; a young individual of various animals related to the goatGOAT: any of various hollow-horned ruminant mammals (especially of the genus Capra) related to the sheep but of lighter build and with backwardly arching horns, a short tail, and usually straight hair, especially: one (Capra hircus) long domesticated for its milk, wool, and fleshIBEX: any of several wild goats (genus Capra, especially C. ibex) living chiefly in high mountain areas of the Old World and having large recurved horns transversely ridged in frontKIDDED: to bring forth young, used of a goat or an antelopeKIDDING: to bring forth young, used of a goat or an antelope
POLLARD*: a hornless goat, deer, ox, etc. [Collins]YEAN*: to bring forth young —used of a sheep or goat
Mammals: Cervine (deer)
BEAM: the main stem of a deer's antlerBELL: a bell-shaped organ or part (such as the dewlap of a moose)BUCK: a male animal, especially: a male deer or antelope; also, buckskin, the skin of a buck: a soft pliable usually suede-finished leather, such as used for making garments, shoes, etc.BUGLING: to utter the characteristic rutting call of the bull elkFAWN: a young deer, especially: one still unweaned or retaining a distinctive baby coatFLAG: the tail of a deerHART: chiefly British: the male of the red deer especially when over five years old: a stag (compare to hind)HIND: chiefly British: the female of the red deer (compare to hart)HORN: an antler, one of the paired deciduous solid bony processes that arise from the frontal bone on the head of an animal of the deer familyPOINT: a tine, a pointed branch of an antler
POLLARD*: a hornless goat, deer, ox, etc. [Collins]PRONG: a point of an antlerRACK: a pair of antlersROYAL: a stag of 8 years or more having antlers with at least 12 pointsTINE: a pointed branch of an antlerVELVET: the soft vascular skin that envelops and nourishes the developing antlers of deerYARD: a locality in a forest where deer herd in winter; also, to congregate in or as if in a yard
Mammals: Equine
ASSES: plural of ass, any of several hardy gregarious African or Asian perissodactyl mammals (genus Equus) smaller than the horse and having long ears, especially: an African mammal (E. africanus) that is the ancestor of the donkey
BARB: any of a northern African breed of horses that are noted for speed and endurance; French barbe, from Italian barbero, from barbero of Barbary, from Barberia Barbary, coastal region in AfricaBRONC: short for bronco, an unbroken or imperfectly broken range horse of western North AmericaBRONCO: an unbroken or imperfectly broken range horse of western North America: a broncBURRO: a donkey, especially: a small donkey used as a pack animalCHUNK: a strong thickset horse usually smaller than a draft horseCOBS: plural of cob, a stocky short-legged riding horseCOCKTAIL: a horse with its tail dockedCOLT: a young male horse, donkey, etc., esp. uncastrated and under the age of four years; a foal, especially: a male foal; also, a young male horse that is usually not castrated and has not attained an arbitrarily designated age (such as four years)DOBBIN*: a farm horse, or a quiet plodding horseEQUINE: of, relating to, or resembling a horse or the horse familyFILLY: a young female horse usually of less than four yearsFOAL: a young animal of the horse family, especially: one under one year; also, to give birth to a foalFOALS: a young animal of the horse family, especially: one under one year; also, to give birth to a foalFROG: the triangular elastic horny pad in the middle of the sole of the foot of a horseGALLOP: a bounding gait of a quadruped, specifically: a fast natural usually 4-beat gait of the horseHACK: a horse let out for common hire; also, a horse used in all kinds of work; or a horse worn out in service: a jade; also, a light easy saddle horse, especially: a three-gaited saddle horse; shortened from Hackney, Middle English hakeney, hakenay "a small saddle horse, especially one for hire," probably from hackney, originally a parish and village, where nearby meadows may have been used to pasture horses; hackney = horse let out for hire ordinary horse and anything related to it (gait, style, etc.)HACKNEY: a horse let out for common hire; also, a horse used in all kinds of work; or a horse worn out in service: a jade; also, a light easy saddle horse, especially: a three-gaited saddle horse; from Hackney, Middle English hakeney, hakenay "a small saddle horse, especially one for hire," probably from hackney, originally a parish and village, where nearby meadows may have been used to pasture horses; hackney = horse let out for hire ordinary horse and anything related to it (gait, style, etc.)HINNY: a hybrid between a stallion and a female donkeyJACK: a male donkeyJADE: a broken-down, vicious, or worthless horseJENNY: a female donkey; from the name JennyLOPE: an easy natural gait of a horse resembling a canter; also, an easy usually bounding gait capable of being sustained for a long time; also, to move or ride at a lopeLOPING: an easy natural gait of a horse resembling a canter; also, an easy usually bounding gait capable of being sustained for a long time; also, to move or ride at a lopeMULE: a hybrid between a horse and a donkey, especially: the offspring of a male donkey and a mareNAGGY: [noun] a little nag: a ponyPAINT: or paint horse: a horse marked with patches of white and another color: a pinto, a horse or pony of various breeding that is marked with patches of white and another color; specifically: an American Paint Horse: any of a breed of horses developed in the U.S. from quarter horse or Thoroughbred ancestry that have irregular broad markings of white interspersed with some other solid colorPINTO: a horse or pony of various breeding that is marked with patches of white and another colorPITCH: of a horse or mule, to buck: to spring into the air with the back archedPITCHED: of a horse or mule, to buck: to spring into the air with the back archedPITCHING: of a horse or mule, to buck: to spring into the air with the back archedPLUG: an inferior often aged or unsound horsePONY: a small horse, especially: one of any of several breeds of very small stocky animals noted for their gentleness and endurance; also, a bronco, mustang, or similar horse of the western U.S.; also, racehorse —usually used in pluralPRANCING: [of a horse or other animal]: to spring from the hind legs or move by so doing; also, to cause (a horse) to prance; also, to ride on a prancing horseRATTAIL: a horse's tail with little or no hairROAN: an animal (such as a horse) with a roan coat —usually used of a red roan when unqualifiedWHINNIED: the neigh of a horse especially when low or gentle; also, to neigh especially in a low or gentle wayWHINNY: the neigh of a horse especially when low or gentle; also, to neigh especially in a low or gentle wayWHINNYING: the neigh of a horse especially when low or gentle; also, to neigh especially in a low or gentle way
Mammals: Feline
ALLEYCAT: M-W has the open compound alley cat, a stray catBOBCAT: a common North American lynx (Lynx rufus) reddish in base color with dark markingsCATTILY: like a catCATTY: resembling a cat; of or relating to a catCHEETAH: a long-legged, swift-moving cat (Acinonyx jubatus) about the size of a small leopard with a yellowish to tan coat covered with numerous round to oval black spots and blunt claws that only partially retract and having a current range restricted to Africa and isolated parts of IranFELID: a cat, or related to catsFELINE: a cat, or related to catsKITTEN: a young cat; also, to give birth to kittens KITTY: a cat, especially a kittenLEONINE: of, relating to, suggestive of, or resembling a lionLION: a large heavily built social cat (Panthera leo) of open or rocky areas chiefly of sub-Saharan Africa though once widely distributed throughout Africa and southern Asia that has a tawny body with a tufted tail and a shaggy blackish or dark brown mane in the male; also, any of several large wildcats, especially the cougar (a large powerful tawny-brown cat (Puma concolor synonym Felis concolor) formerly widespread in the Americas but now reduced in number or extinct in many areas, called also catamount, mountain lion, panther, puma)LYNX: any of several wildcats with relatively long legs, a short stubby tail, mottled coat, and usually tufted ears that are thought to comprise a distinct genus (Lynx) of the cat family or to be part of a genus (Felis) that includes the domestic cat and cougar: such as a lynx (L. lynx) of northern Europe and Asia; the bobcat; a North American lynx (L. canadensis) distinguished from the bobcat by its larger size, longer tufted ears, and wholly black tail tip; called also Canadian lynxOCELOT: a medium-sized American wildcat (Leopardus pardalis synonym Felis pardalis) that ranges from Texas to northern Argentina and has a tawny-yellow or grayish coat dotted and striped with blackOUNCE: the snow leopardPUMA: a large powerful tawny-brown cat (Puma concolor synonym Felis concolor) formerly widespread in the Americas but now reduced in number or extinct in many areas; called also catamount, mountain lion, panther, pumaPURR: a low vibratory murmur typical of an apparently contented or pleased cat; also, to make a purr or a sound like a purr (cars purring along the highway)PURRING: a low vibratory murmur typical of an apparently contented or pleased cat; also, to make a purr or a sound like a purr (cars purring along the highway)QUEEN: a mature female cat kept especially for breedingTABBY: a domestic cat with a striped and mottled coat; also; [any] domestic cat, especially: a female cat; from French tabis, from Middle French atabis, from Medieval Latin attabi, from Arabic ʽattābī, from Al-ʽAttābīya, quarter in BaghdadTOMCAT: a male domestic catWILDCAT: either of two Old World cats (Felis silvestris or F. lybica) that resemble but are heavier in build than the domestic tabby cat and are usually held to be among the ancestors of the domestic cat; also, any of various small or medium-sized cats (such as the lynx or ocelot); also, a feral domestic catYOWL: a loud long mournful wail or howl (as of a cat); also, to utter a loud long cry of grief, pain, or distress: to wail; to complain or protest with or as if with yowls; to express with yowling
Mammals: Leporine (hares and rabbits)
ANGORA: the hair of the Angora rabbit or Angora goat, or a yarn of Angora rabbit hair used especially for knitting. (In the names of animals -- Angora cat, Angora rabbit, Angora goat – the adjective is proper.) From Ankara (historically known as Angora), in present-day Turkey.BUNNY: informal: rabbit, especially: a young rabbitFORM: the resting place or nest of a hareJACK: a jackrabbit, any of several large hares (genus Lepus) of western North America having very long ears and long hind legsRABBIT: any of a family (Leporidae) of long-eared short-tailed lagomorph mammals with long hind legs; any of various lagomorphs that are born furless, blind, and helpless, that are sometimes gregarious, and that include especially the cottontails of the New World and a small Old World mammal (Oryctolagus cuniculus) that is the source of various domestic breeds, or a hare, any of various swift, gnawing, herbivorous, usually shy lagomorph mammals (family Leporidae and especially genus Lepus) that have long ears, short tails, and powerful long hind legs, are usually solitary or sometimes live in pairs, have the young open-eyed and furred at birth, and live in aboveground nests
Mammals: Marine
BALEEN: a horny keratinous substance found in two rows of transverse plates which hang down from the upper jaws of baleen whalesBLEW: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBLOW: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBLOWING: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBLOWN: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBULL: a usually adult male of various large animals (such as whales, or seals); also, of or relating to a bull; also, suggestive of a bull; also, male (a bull calf)CETACEAN: any of an order (Cetacea) of aquatic mostly marine mammals that includes the whales, dolphins, porpoises, and related forms…DOLPHIN: any of various small marine toothed whales (family Delphinidae) with the snout more or less elongated into a beak and the neck vertebrae partially fused; also, any of several related chiefly freshwater toothed whales (as of the families Platanistidae and Iniidae): river dolphin, any of various small, toothed whales (as of the families Platanistidae and Iniidae) that chiefly inhabit rivers of South America and Asia and have a rounded forehead and a snout elongated into a long beakDUGONG: an aquatic, herbivorous, usually brownish-gray mammal (Dugong dugon) that inhabits warm coastal waters chiefly of southern Asia, Australia, and eastern Africa and resembles the related manatee…MANATEE: any of a genus (Trichechus of the family Trichechidae) of large, herbivorous, aquatic mammals that inhabit warm coastal and inland waters of the southeastern U.S., West Indies, northern South America, and West Africa and have a rounded body, a small head with a squarish snout, paddle-shaped flippers usually with vestigial nails, and a flattened, rounded tail used for propulsionMELON: a rounded organ in the front of the head of some cetaceans and all toothed whales that is composed of lipids and waxy material and is thought to be utilized in echolocationORCA: a relatively small toothed whale (Orcinus orca of the family Delphinidae) that is black above with white underparts and white oval-shaped patches behind the eyes: A killer whalePINNIPED: any of an order or suborder (Pinnipedia) of aquatic carnivorous mammals (such as a seal or walrus) with all four limbs modified into flippersTAILFIN*: M-W has tail fin, the terminal fin of a fish or cetaceanWHALE: any of various very large, aquatic, marine mammals (order Cetacea) that have a torpedo-shaped body with a thick layer of blubber, paddle-shaped forelimbs but no hind limbs, a horizontally flattened tail, and nostrils that open externally at the top of the head
Mammals: Marsupials and Monotremes
ECHIDNA: a spiny-coated toothless burrowing nocturnal monotreme mammal (Tachyglossus aculeatus) of Australia, Tasmania, and New Guinea that has a long extensible tongue and long heavy claws and that feeds chiefly on ants; also: several related mammals (genus Zaglossus) of New Guinea having a longer snout and shorter spinesJOEY: Australia: a baby animal, especially: a baby kangarooKOALA: an Australian arboreal marsupial (Phascolarctos cinereus) that has a broad head, large hairy ears, dense gray fur, and sharp claws and feeds on eucalyptus leaves; called also koala bearNUMBAT: a small Australian marsupial (Myrmecobius fasciatus of the family Myrmecobiidae) that has a reddish-brown coat with white stripes on the back, a pointed snout, and a long slender tongue used to feed chiefly on termites; called also banded anteaterPLATYPI: plural of platypus, a small carnivorous aquatic monotreme mammal (Ornithorhynchus anatinus) of eastern Australia and Tasmania that has a fleshy bill resembling that of a duck, dense fur, webbed feet, and a broad flattened tailWALLAROO: a large reddish-gray kangaroo (Osphranter robustus), called also euro; also, either of two kangaroos (O. antelopinus and O. bernardus) related to the wallaroo
Mammals: Others
BATTY: of, relating to, or resembling a batBOAR: the male of any of several mammals (such as a guinea pig or bear)BRUIN: a bear, any of a family (Ursidae of the order Carnivora). From Middle Dutch, the name of the bear in Reynard the Fox.BULL: a usually adult male of various large animals (such as elephants); also, of or relating to a bull; also, suggestive of a bull; also, male (a bull calf)CAMEL: either of two large ruminant mammals (genus Camelus) that have one or two large humps of stored fat on the back and are used as draft and saddle animals in desert regions especially of Africa and Asia; also, leather made from the skin of a camelCAMELBACK: the back of a camelCIVET: any of various Old World carnivorous viverrid mammals with long bodies, short legs, and a usually long tailCOATI: either of two tropical American mammals (Nasua nasua and N. narica) related to the raccoon but with a longer body and tail and a long flexible snoutCOON*: short for raccoon, a small nocturnal carnivore (Procyon lotor) of North America that is chiefly gray, has a black mask and bushy ringed tail, lives chiefly in trees, and has a varied diet including small animals, fruits, and nuts; also, the pelt of this animal; also, any of several animals resembling or related to the raccoonELEPHANT: a thickset, usually extremely large, nearly hairless, herbivorous mammal (family Elephantidae, the elephant family)GLUTTON: the wolverine, a carnivorous usually solitary mammal (Gulo gulo) of the weasel family of northern forests and associated tundra that is dark brown with a light brown band on each side of the body and is noted for its strengthHIPPO: short for hippopotamus, any of a family (Hippopotamidae) of very large, four-toed, chiefly aquatic, herbivorous artiodactyl mammals…LLAMA: any of a genus (Lama) of wild or domesticated, long-necked, South American ruminant mammals related to the camels but smaller and without a hump, especially: a domesticated llama (L. glama) descended from the guanaco and used especially in the Andes as a pack animal and a source of woolMAMMAL: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMALIAN: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMOTH: any of a genus (Mammuthus) of extinct Pleistocene mammals of the elephant family distinguished from recent elephants by highly ridged molars, usually large size, very long tusks that curve upward, and well-developed body hairMINK: either of two slender-bodied semiaquatic carnivorous mammals (Neogale vison of North America and Mustela lutreola of Eurasia) of the weasel family that have partially webbed feet, a rather short bushy tail, and a soft thick coatMOLE: any of numerous burrowing insectivores (especially family Talpidae) with tiny eyes, concealed ears, and soft furPANDA: the red panda, a small, largely arboreal mammal (Ailurus fulgens of the family Ailuridae) that resembles the American raccoon, that is found from the Himalayas to China, and that has long rusty or chestnut fur with dark underparts, a long bushy tail with rings, and a white face and inner ears with a dark stripe from the corners of the eyes to the lower jaw; called also lesser panda; also, a large black-and-white mammal (Ailuropoda melanoleuca) of chiefly central China that feeds primarily on bamboo shoots and is now usually classified with the bears (family Ursidae); called also giant pandaPLACENTAL: of or relating to a major division (Eutheria) of mammals comprising the placental mammals; a placental mammal: a eutherianRACCOON: a small nocturnal carnivore (Procyon lotor) of North America that is chiefly gray, has a black mask and bushy ringed tail, lives chiefly in trees, and has a varied diet including small animals, fruits, and nuts; also, any of several animals resembling or related to the raccoonRHINO: any of a family (Rhinocerotidae) of large heavyset herbivorous perissodactyl mammals of Africa and Asia that have one or two upright keratinous horns on the snout and thick gray to brown skin with little hairTAPIR: any of a genus (Tapirus) of herbivorous chiefly nocturnal perissodactyl mammals of tropical America and southeastern Asia from Myanmar to Sumatra that have a heavy sparsely hairy body and the snout and upper lip prolonged into a short flexible proboscisUNGULATE: a hoofed typically herbivorous quadruped mammal (such as a pig, cow, deer, horse, elephant, or rhinoceros) of a group formerly considered a major mammalian taxon (Ungulata); also, of, relating to, or affecting ungulates (ungulate diseases); also, having hooves (ungulate mammals)
Mammals: Ovine
BAAED: to make the bleat of a sheepBAAING: to make the bleat of a sheepBLAT: alteration of bleat, to cry like a calf or sheep: to bleat; also, the sound made by blattingBLEAT: or blat, the cry of a sheep or goat; also, to make the natural cry of a sheep or goatDOWN: often capitalized: a sheep of any breed originating in the downs of southern EnglandFALL: to become born, usually used of lambsFALLEN: to become born, usually used of lambsFALLING: to become born, usually used of lambsFALLS: to become born, usually used of lambsFELL: to become born, usually used of lambsFLEECE: the coat of wool covering a wool-bearing animal (such as a sheep)FLOCK: a group of animals (such as birds or sheep) assembled or herded togetherGELT: M-W does not have this definition: An adult, female sheep that is not in lamb when others are. Often she has been kept away from the ram because of problems at a previous lambing. Gelt ewes are fattened for sale to the meat trade at a time when lamb is in short supplyLAMB: a young sheep, especially: one that is less than one year old or without permanent teeth also, to bring forth (give birth to) a lambOVINE: of, relating to, or resembling sheepWOOL: the soft wavy or curly usually thick undercoat of various hairy mammals and especially the sheep made up of a matrix of keratin fibers and covered with minute scalesYEAN*: to bring forth young —used of a sheep or goatYOLK: oily material in unprocessed sheep wool consisting of wool fat, suint, and debrisYOLKY: full of yolk: greasy —used of unwashed wool
Mammals: Porcine
BARROW: a male hog castrated before sexual maturityBOAR: an uncastrated male swine; also, an Old World wild hog (Sus scrofa) from which most domestic swine have been derivedFARROW: of swine: to give birth to young; also, a litter of pigs or an act of farrowing; also, of a cow: not pregnantGILT: a young female swineJAVELINA: the peccary, any of several largely nocturnal gregarious American mammals resembling the related pigs…PIGGED: to farrow, to give birth to (a farrow)PIGGING: to farrow, to give birth to (a farrow)PIGGY: piggish: of, relating to, or suggestive of a pig (a piggish snort); also, having qualities associated with a pig RAZORBACK: a thin-bodied long-legged feral hog chiefly of the southeastern U.S.RUNT: an animal unusually small of its kind, especially: the smallest of a litter of pigsRUNTY: an animal unusually small of its kind, especially: the smallest of a litter of pigsWARTHOG: either of two wild African hogs (Phacochoerus aethiopicus or P. africanus) that have large protruding tusks and in the male two pairs of rough warty excrescences on the face
Mammals: Primates
APEMAN: M-W hyphenates ape-man, a primate (such as an australopithecine) intermediate in character between Homo sapiens and the higher apesAPEMEN: M-W hyphenates ape-men, a primate (such as an australopithecine) intermediate in character between Homo sapiens and the higher apesBABOON: any of a genus (Papio) of large gregarious primates of Africa and southwestern Asia having a long square naked muzzleBONOBO: a rare anthropoid ape (Pan paniscus) that has a more slender build and longer limbs than the related common chimpanzee (P. troglodytes) and that inhabits a small geographic region in equatorial Africa south of the Congo RiverCHIMP: short for chimpanzee, an anthropoid ape (Pan troglodytes) of equatorial Africa that is smaller and more arboreal than the gorillaDRILL: a western African baboon (Mandrillus leucophaeus synonym Papio leucophaeus) having a black face and brown coat and closely related to the mandrillGIBBON: any of a genus (Hylobates of the family Hylobatidae) of agile brachiating tailless apes of southeastern Asia that are the smallest and most arboreal anthropoid apesGORILLA: a very large typically black-colored anthropoid ape (Gorilla gorilla) of equatorial Africa … from Greek Gorillai, plural, a tribe of hairy women mentioned in an account of a voyage around AfricaHAND: the hind foot of an ape; also, the terminal part of the vertebrate forelimb when modified (as in primates) as a grasping organ: the body part at the end of the arm of a human, ape, or monkeyHOMINID: any of a family (Hominidae) of erect bipedal primate mammals that includes recent humans together with extinct ancestral and related forms and in some recent classifications the great apes (the orangutan, gorilla, chimpanzee, and bonobo)HOMINOID: any of a superfamily (Hominoidea) of primates including recent hominids, gibbons, and pongids together with extinct ancestral and related forms (as of the genera Proconsul and Dryopithecus)HUMAN: a bipedal primate mammal (Homo sapiens): a person: ; broadly: hominid; a man, a bipedal primate mammal (Homo sapiens) that is anatomically related to the great apes but distinguished especially by notable development of the brain with a resultant capacity for articulate speech and abstract reasoning, and is the sole living representative of the hominid family; broadly: any living or extinct hominidMAKI: a lemur, any of various arboreal diurnal or nocturnal, chiefly arboreal primates (superfamily Lemuroidea) of Madagascar and the Comoros Islands that usually have a longish muzzle, large eyes, very soft woolly fur, and a long furry tail and that feed on fruit and plant parts (such as leaves, flowers, and seeds) and sometimes insects and small animalsMONK: a monkeyNAIL: a horny sheath protecting the upper end of each finger and toe of humans and most other primatesORANG: an orangutan, any of several largely herbivorous arboreal anthropoid apes (Pongo pygmaeus, P. abelii, and P. tapanuliensis) of Borneo and Sumatra that are about ²/₃ as large as the gorilla and have brown skin, long sparse reddish-brown hair, and very long armsORANGUTAN: any of several largely herbivorous arboreal anthropoid apes (Pongo pygmaeus, P. abelii, and P. tapanuliensis) of Borneo and Sumatra that are about ²/₃ as large as the gorilla and have brown skin, long sparse reddish-brown hair, and very long armsTAMARIN: any of numerous small chiefly South American monkeys (genus Saguinus) that are related to the marmosets and have silky fur, a long tail, and lower canine teeth that are longer than the incisors
Mammals: Rodents
CHINCHILLA: either of two small South American rodents (Chinchilla laniger and C. brevicaudata of the family Chinchillidae) of the high Andes that are the size of large squirrels, have very soft pearly-gray fur, and are extensively bred in captivity; also: the fur of a chinchillaGROUNDHOG: a woodchuck, a grizzled thickset marmot (Marmota monax) chiefly of Alaska, Canada, and the northeastern U.S.LEMMING: any of various small short-tailed furry-footed rodents (such as genera Lemmus and Dicrostonyx) of circumpolar distribution that are notable for population fluctuations and recurrent mass migrationsMARMOT: any of a genus (Marmota) of stout-bodied short-legged chiefly herbivorous burrowing rodents of the squirrel family that have coarse fur, a short bushy tail, and very small ears and that hibernate during the winterMICE: plural of mouse, any of numerous small rodents (as of the genus Mus) with pointed snout, rather small ears, elongated body, and slender tailPACKRAT: M-W has pack rat, the wood rat, any of numerous soft-furred cricetid rodents (especially genus Neotoma) of North and Central America that have well-furred tails, large ears, and a characteristic tendency to hoard food and debris on or near their dens; called also pack rat, especially: a bushy-tailed rodent (Neotoma cinerea) of western North America that has well-developed cheek pouches and that hoards food and miscellaneous objectsPORKY: by shortening from porcupine, any of various relatively large slow-moving chiefly herbivorous rodents having sharp erectile spines mingled with the hair and constituting an Old World terrestrial family (Hystricidae) and a New World chiefly arboreal family (Erethizontidae)QUILL: one of the hollow sharp spines of a porcupine or hedgehog; also, a pen, the internal horny feather-shaped shell of a squidRATTY: of, relating to, or suggestive of a rat; also, infested with ratsVOLE: any of various small rodents (Microtus and related genera) that typically have a stout body, rather blunt nose, and short ears, inhabit both moist meadows and dry uplands and do much damage to crops, and are closely related to muskrats and lemmings
Microorganisms
AMEBA: more commonly amoeba, any of a large genus (Amoeba) of naked rhizopod protozoans…AMEBAE: more commonly amoebae, any of a large genus (Amoeba) of naked rhizopod protozoans…AMEBIC: more commonly amoebic, any of a large genus (Amoeba) of naked rhizopod protozoans…AMOEBA: or less commonly ameba, any of a large genus (Amoeba) of naked rhizopod protozoans…AMOEBAE: or less commonly amebae, any of a large genus (Amoeba) of naked rhizopod protozoans…BACILLI: any of a genus (Bacillus) of rod-shaped gram-positive usually aerobic bacteria; bacterium, especially: a disease-producing bacteriumCOCCI: plural of coccus, any spherical or roughly spherical bacteriumCOLONY: a circumscribed mass of microorganisms usually growing in or on a solid medium (colonies of bacteria); also, the aggregation of zooids of a compound animal (such as a coral or bryozoan) (a coral colony)FILM: a thin skin or membranous covering: a pellicle: an outer membrane of some protozoans (such as euglenoids or paramecia)FLAGELLA: plural of flagellum, any of various elongated filiform appendages of plants or animals: such as the slender distal part of an antenna; also, a long tapering process that projects singly or in groups from a cell and is the primary organ of motion of many microorganismsGULLET: an invagination of the protoplasm in various protozoans (such as a paramecium) that sometimes functions in the intake of foodMONAD: a flagellated protozoan (as of the genus Monas)PELLICLE: an outer membrane of some protozoans (such as euglenoids or paramecia)PLANKTON: the passively floating or weakly swimming usually minute organisms (such as dinoflagellates, diatoms, copepods, radiolarians, and larval crustaceans and fish) of a body of waterVALVE: one of the two encasing membranes of a diatom, any of a class (Bacillariophyceae) of minute planktonic unicellular or colonial algae with silicified skeletons that form diatomaceous earth
Mollusks and Crustaceans
ABALONE: any of a genus (Haliotis) of edible rock-clinging gastropod mollusks that have a flattened shell slightly spiral in form, lined with mother-of-pearl, and with a row of apertures along its outer edgeANTENNA: one of a pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansANTENNAE: the pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansARGONAUT: a pelagic cephalopod (genus Argonauta) of which the female has a delicate papery shell (uncapitalized)BIVALVE: any of a class (Bivalvia synonym Pelecypoda) of typically marine mollusks (such as clams, oysters, or scallops) that have a 2-valved hinged shell, are usually filter feeders, and lack a distinct headCLAM: any of numerous edible marine bivalve mollusks living in sand or mud, or a freshwater musselCOCKLE: any of various chiefly marine bivalve mollusksCONCH: any of various large spiral-shelled marine gastropod mollusks; also: its shell used especially for cameosCONE: any of a family (Conidae) of tropical marine gastropod mollusks that inject their prey with a potent toxinCORAL: a bright reddish ovary (as of a lobster or scallop)CRAB: any of numerous chiefly marine broadly built decapod crustaceans: any of an infraorder (Brachyura) with a short broad usually flattened carapace, a small abdomen that curls forward beneath the body, short antennae, and the anterior pair of limbs modified as grasping pincers; also, any of various crustaceans of an infraorder (Anomura) resembling true crabs in the more or less reduced condition of the abdomenCRAWDAD: crayfish, used chiefly west of the Appalachians: any of numerous freshwater decapod crustaceansCRAY*: crayfish (Australia and New Zealand): any of numerous freshwater decapod crustaceansCUTTLE: cuttlefish: any of various marine cephalopod mollusks (order Sepioidea, especially genus Sepia) having eight short arms and two usually longer tentacles and differing from the related squid in having a calcified internal shellDRILL: a marine snail (Urosalpinx cinerea) destructive to oysters by boring through their shells and feeding on the soft parts; also, any of several mollusks related to the drillFOOT: a ventral muscular surface or process of a molluskHAND: the chela of a crustaceanJELLY: a jellyfishKRILL: planktonic crustaceans and their larvae (order or suborder Euphausiacea and especially genus Euphausia) that constitute the principal food of baleen whalesLAMELLA*: one of the thin plates composing the gills of a bivalve molluskLAMELLAE*: plural of lamella, one of the thin plates composing the gills of a bivalve molluskLIMPET: a marine gastropod mollusk (especially families Acmaeidae and Patellidae) that has a low conical shell broadly open beneath, browses over rocks or timbers in the littoral area, and clings very tightly when disturbedLITTLENECK: a young quahog suitable to be eaten raw; called also littleneck clam; named for Littleneck Bay, Long Island, New YorkMANTLE: a fold or lobe or pair of lobes of the body wall of a mollusk or brachiopod that in shell-bearing forms lines the shell and bears shell-secreting glands; also, the soft external body wall that lines the test or shell of a tunicate or barnacleNAUTILI: plural of nautilus, any of a genus (Nautilus) of cephalopod mollusks of the South Pacific and Indian oceans with a spiral chambered shell that is pearly on the inside; called also chambered nautilusNECK: the siphon of a bivalve mollusk (such as a clam)OCTOPI: plural of octopus, any of a genus (Octopus) of cephalopod mollusks that have eight muscular arms equipped with two rows of suckers; broadly: any octopod excepting the paper nautilusOCTOPOD: any of an order (Octopoda) of cephalopod mollusks (such as an octopus or argonaut) that have eight arms bearing sessile suckersPRAWN: any of various widely distributed edible decapod crustaceans: such as one (as of the genera Pandalus and Penaeus) that resembles shrimp and has a large compressed abdomen; also, a shrimp, especially: a large shrimp; also, a langoustine, a small edible lobster (Nephrops norvegicus) of European seas having long slender clawsQUILL: a pen, the internal horny feather-shaped shell of a squidTHORACIC: the middle of the three chief divisions of the body of an insect; also, the corresponding part of a crustacean or an arachnidTRITON: any of various large marine gastropod mollusks (family Ranellidae synonym Cymatiidae) with a heavy elongated conical shell; also: the shell; Latin, from Greek Tritōn, a son of Poseidon described as a demigod of the sea with the lower part of his body like that of a fishVALVE: one of the distinct usually hinged and movable pieces of which the shell of some shell-bearing animals (such as lamellibranch mollusks, brachiopods, and barnacles) consistsVEIL: a covering body part or membrane: such as the velum, a membrane or membranous part resembling a veil or curtain: such as an annular membrane projecting inward from the margin of the bell in some jellyfishes (such as the hydromedusae); also, a swimming organ that is especially well developed in the later larval stages of many marine gastropodsVELUM: a membrane or membranous part resembling a veil or curtain: such as an annular membrane projecting inward from the margin of the bell in some jellyfishes (such as the hydromedusae); also, a swimming organ that is especially well developed in the later larval stages of many marine gastropodsWHORL: one of the turns of a univalve shell, of a mollusk with a shell consisting of one valveWINKLE: any of various gastropod mollusks: such as any of a genus (Littorina) of edible littoral marine snails; also: any of various similar or related marine snails; any of several North American freshwater snails
Reptiles
ALLIGATOR: either of two large carnivorous, thick-skinned, long-bodied, aquatic, crocodilian reptiles (Alligator mississippiensis of the southeastern U.S. and A. sinensis of China) that have a broad head with a slightly tapered, long, rounded, U-shaped snout and a special pocket in the upper jaw for reception of the enlarged lower fourth toothANACONDA: a large semiaquatic constricting snake (Eunectes murinus) of the boa family of tropical South America that may reach a length of 30 feet (9.1 meters); broadly: any of the large constricting snakesARMADILLO: any of a family (Dasypodidae) of burrowing edentate mammals found from the southern U.S. to Argentina and having the body and head encased in an armor of small bony platesBUTTON: the terminal segment of a rattlesnake's rattleCAIMAN: or less commonly cayman, any of several Central and South American crocodilians (genera Caiman, Melanosuchus, and Paleosuchus) similar to alligatorsCAYMAN: less common spelling of caiman, any of several Central and South American crocodilians (genera Caiman, Melanosuchus, and Paleosuchus) similar to alligatorsCOBRA: any of several venomous Asian and African elapid snakes (genera Naja and Ophiophagus) that when excited expand the skin of the neck into a hood by movement of the anterior ribsCOTTONMOUTH: a water moccasin, a venomous semiaquatic pit viper (Agkistrodon piscivorus) chiefly of the southeastern U.S. that is closely related to the copperhead; or a harmless American colubrid water snake (genus Nerodia) resembling the true water moccasinCROC: short for crocodile, any of several large, carnivorous, thick-skinned, long-bodied, aquatic reptiles (family Crocodylidae and especially genus Crocodylus) of tropical and subtropical waters that have a long, tapered, V-shaped snout; broadly: crocodilian, any of an order (Crocodylia) of reptiles including the crocodiles, alligators, caimans, gharials, and related extinct forms; also, the skin or hide of a crocodileDINO: shortened form of dinosaurFANG: one of the long hollow or grooved and often erectile teeth of a venomous snakeFANGED: one of the long hollow or grooved and often erectile teeth of a venomous snakeGATOR: short for alligator, either of two large carnivorous, thick-skinned, long-bodied, aquatic, crocodilian reptiles (Alligator mississippiensis of the southeastern U.S. and A. sinensis of China) that have a broad head with a slightly tapered, long, rounded, U-shaped snout and a special pocket in the upper jaw for reception of the enlarged lower fourth toothGECKO: any of numerous small chiefly tropical and nocturnal insectivorous lizards (family Gekkonidae)IGUANA: any of various large chiefly herbivorous usually green or brownish tropical American lizards (family Iguanidae, the iguana family) that have a serrated dorsal crest and large dewlapLIZARD: any of a suborder (Lacertilia) of reptiles distinguished from the snakes by a fused inseparable lower jaw, a single temporal opening, two pairs of well differentiated functional limbs which may be lacking in burrowing forms, external ears, and eyes with movable lids; broadly: any relatively long-bodied reptile (such as a crocodile or dinosaur) with legs and tapering tailMAMBA: any of several chiefly arboreal venomous green or black elapid snakes (genus Dendroaspis) of sub-Saharan AfricaMILK: to induce (a snake) to eject venomMONITOR: the monitor lizard, any of various tropical carnivorous lizards (genus Varanus of the family Varanidae) of Australia, Asia, and AfricaPYTHON: any of various large constricting snakes, especially: any of the large oviparous snakes (subfamily Pythoninae of the family Boidae) of Africa, Asia, Australia, and adjacent islands that include some of the largest existing snakes; Latin, monstrous serpent killed by Apollo, from Greek Pythōn, from Pythō DelphiRAPTOR: a usually small-to-medium-sized predatory dinosaur (such as a velociraptor or deinonychus)
Words about Animals
ANIMAL: any of a kingdom (Animalia) of living things including many-celled organisms and often many of the single-celled onesANIMATE: of or relating to animal life as opposed to plant lifeAQUATIC: growing or living in or frequenting waterBIOTA: the flora and fauna of a regionENDEMIC: an organism that is restricted or peculiar to a locality or region: an endemic organismFAUNA: animal life, especially: the animals characteristic of a region, period, or special environment; from Latin Fauna, sister of FaunusFAUNAE: plural of fauna: animal life, especially: the animals characteristic of a region, period, or special environment; from Latin Fauna, sister of FaunusFAUNAL: related to fauna: animal life, especially: the animals characteristic of a region, period, or special environment; from Latin Fauna, sister of FaunusMAMMAL: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMALIAN: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMALOGY: a branch of zoology dealing with mammalsPEOPLE: lower animals usually of a specified kind or situation (Collins has “Archaic, a group of creatures: the ant people)RATTRAP: a trap for ratsUNHUMAN: inhuman: of or suggesting a nonhuman class of beingsUNHUMANLY: inhuman: of or suggesting a nonhuman class of beingsVARMINT: an animal considered a pest, specifically: one classed as vermin and unprotected by game lawWAIF: a stray animalZOOLOGIC: variants or more commonly zoological: of, relating to, or affecting animals that are not humans (a zoological park)ZOOLOGICAL: variants or less commonly zoologic: of, relating to, or affecting animals that are not humans (a zoological park)
Spelling Bee words related to ANIMALS
ABALONEABDOMENADDLEADDLEDADDLINGADMIRALALBINOALBUMENALIGHTALIGHTINGALITALLEYCATALLIGATORALPACAALPHAAMAZONAMEBAAMEBAEAMEBICAMOEBAAMOEBAEAMPHIBIANANACONDAANCHOVYANEMONEANGELANGORAANIMALANIMATEANKLEANTENNAANTENNAEANTHILLAPEMANAPEMENAPHIDAPIANAPIARIAN*APIARYAPIARYAPOLLO*AQUATICARACHNIDARGONAUTARMADILLOARTHROPODASSESATTRACTANTAUKSAVIANAVIARYAVOCETBAAEDBAAINGBABOONBACILLIBACKBALDBALEENBANDBANDEDBANDINGBANTAMBARBBARKBARRINGBARROWBATEBATEDBATTYBAYEDBAYINGBEAGLEBEAKBEAKEDBEAMBEANBEATBEEFBEEHIVEBEEKEEPINGBEELINEBEETLEBELLBELLEDBELLINGBELLOWBELLOWEDBELLYBEVYBIDDYBIGEYEBIGHEADBIGHEADEDBILLBILLEDBILLYBIOTABIRDBIRDBATHBITCH*BITEBITINGBITTENBIVALVEBLACKBLACKCAPBLATBLAZEBLEATBLEWBLITZBLOATBLOODEDBLOODHOUNDBLOOMBLOOMEDBLOOMINGBLOWBLOWINGBLOWNBLUE BLUEBOTTLEBLUEFINBOARBOBCATBOBOLINKBONEBONGOBONITOBONOBOBOOBYBORZOIBOSSBOVIDBOWWOWBRAYBRAYINGBRONCBRONCOBROODBROODYBROWNBRUINBUCKBUFFBUFFALOBUGGYBUGLINGBUILDBULLBULLFROGBULLOCKBUMBLEBEEBUNNYBUNTINGBURBOTBURROBURROWBUTTOCKBUTTONCACKLECACKLEDCACKLINGCAIMANCALFCALICOCALLCALLEDCALLINGCALVECAMELCAMELBACKCANARYCANIDCANINECANNONCAPECAPONCARPCATBIRDCATTILYCATTLECATTYCAWEDCAWINGCAYMANCELLCENTIPEDECETACEANCHARCHARMCHATCHEEPCHEEPEDCHEETAHCHICKCHICKADEECHICKENCHIHUAHUACHIMPCHINCHILLACHIRPCHITINCHOWCHUBCHUMCHUNKCICADACICHLIDCIRRICIVETCLAMCLANGCLANGEDCLANGINGCLAWCLAWINGCLOACACLUCKCLUCKEDCLUTCHCLUTCHEDCOATCOATICOBRACOBSCOBSCOCCICOCKCOCKAPOOCOCKATOOCOCKLECOCKTAILCOCOONCOCOONEDCOCOONINGCOHOCOLLARCOLLIECOLONYCOLTCOMBCOMMACOMPLETECONCHCONDORCONECOOEDCOOINGCOON*COOTCOOTIECORALCORGICORMORANTCORRIDORCOTTONMOUTHCOUCHCOURTCOVEYCOXACOYOTECRABCRAWCRAWDADCRAY*CROAKCROAKYCROCCROPCROUPCROWCRYINGCRYPTICCUCKOOCUCKOOEDCUTICLECUTTLEDABBLINGDACE*DALMATIANDAPPLEDAPPLEDDIGITDINGODINODOBBIN*DOCKDODODOGFIGHTDOGGIEDOGGODOGGYDOGIEDOGTROTDOLPHINDORADODOVEDOWNDOWNYDRIFTDRILLDROPDROPPINGDRUMDUCKDUGONGDUMBEAGLEEAGLETECHIDNAECHOLOCATEEELYELANDELBOWELEPHANTELVERENDEMICEPAULETEQUINEETHOLOGY*FACETFALLFALLENFALLINGFALLSFANCILYFANGFANGEDFANTAILFARROWFAUNAFAUNAEFAUNALFAWNFEEDFEEDINGFELIDFELINEFELLFEMALEFILLYFILMFINCHFINNEDFLAGFLAGELLAFLANKFLAPFLAPPINGFLEAFLEDGEFLEDGEDFLEDGINGFLEDGLINGFLEECEFLEWFLIGHTFLOATFLOCKFLOWNFLUFFFLUFFEDFLUFFILYFLUFFINGFLUFFSFLUFFYFLYINGFOALFOALSFOOTFORAGINGFORMFORMICFOWLFRILLFROGFROGGYFUGUFURRYGAGGLEGAITGALLGALLEDGALLINGGALLOPGANNETGAPEGATORGAZELLEGECKOGELTGIBBONGILLGILTGLUTTONGNARLGNARLINGGNATGOATGOBBLEGOBBLEDGOBBLINGGOBYGOONYGORILLAGRITGRITTINGGROUNDHOGGROWLGRUBGRUBBYGRUNTGUANOGULLGULLETGUPPYHACKHACKEDHACKLEHACKNEYHAGGARDHAIRHAIRYHAKEHALCYONHALIBUTHAMACHIHANDHARTHATCHHAUNCHHAWKHEATHEAVEHEEHAWHEEHAWEDHEELHINDHINNYHIPPOHIVEHIVEDHIVINGHOBBYHOCKHOLEHOLEDHOLINGHOLTHOMEHOMEDHOMINGHOMINIDHOMINOIDHOMOGAMYHONEYHONEYBEEHONEYDEWHONKHONKINGHOODHOODEDHOODIEHOOFHOOFEDHOOPOEHOOTHOOTEDHOOTINGHORNHORNYHOUNDHOWLHOWLINGHUMANHUMPHUNTHUNTEDHYDRAHYENA
IBEXIGUANAIMMIGRANTIMPALAIVORYJACKJACKALJADEJAKEJAVELINAJAYBIRDJELLYJENNYJOEYJOINTJUNCOJUVENILEKEELKELPIEKENNELKETTLEKIDDEDKIDDINGKINGKITEKITINGKITTENKITTYKIWIKNEEKNOTKOALAKRILLKUDULABIALABIALLADYBUGLAIDLAIRLAMBLAMELLA*LAMELLAE*LAMINALAMINAELAMINALLANDLANDEDLANDINGLANGUAGELARKLARVALARVALLAYINGLEGGEDLEGGYLEMMINGLEONINELICELICKLICKEDLICKINGLIFTLIMBLIMPETLINNETLIONLITTLELITTLENECKLIZARDLLAMALOACHLOBAR*LOBELOBEDLOBOLOBOSLODGELOINLONGHORNLOONLOPELOPINGLOWEDLOWINGLUNGLUPINELYNXMAGGOTMAHIMAHIMAILMAKIMAKOMALAMUTEMALARIAMALARIALMALLARDMAMBAMAMMAMAMMALMAMMALIANMAMMALOGYMAMMARYMAMMOTHMANATEEMANEMANGEMANGYMANNAMANTAMANTLEMARKMARLINMARMOTMARTINMATEMATEDMATINGMAXILLAMAYFLYMELANINMELONMEOWMEOWEDMEOWINGMEWEDMEWINGMICEMIDGEMIGRANTMIGRATINGMILKMIMICMIMICKEDMIMICKINGMIMICRYMINKMINNOWMITEMOBBEDMOBBINGMODELMOLEMOLLYMOLTMONADMONARCHMONITORMONKMONOGAMYMOOEDMOOINGMORAYMORPHMOTHMOTHYMOUNTMOUNTEDMOURNMOURNINGMOUTHMULEMULLETMULTIPLYMUTEMUTEDMUTINGMUTTMYNAMYNAHNAGGYNAIADNAILNAKEDNAUTILINEATNECKNEIGHNEIGHEDNEIGHINGNENENERVENEWTNIPPLENOTENUMBATNUPTIALNUTHATCHOCELOTOCTOPIOCTOPODOINKOINKINGOPAH*ORANGORANGUTANORCAORGANORIBI*ORPHANOUNCEOVARYOVINEOVULAROVULEOWLETOXENOXLIKEPACKPACKEDPACKRATPAINTPALPPANDAPAPILLONPARROTPARTPAUNCHPAWINGPEAFOWLPEAHENPECKPECKEDPEEPPEEPEDPEEPINGPEEWEEPEKEPELICANPELLETPELLICLEPENGUINPEOPLEPEWEEPIEDPIGGEDPIGGINGPIGGYPIKEPILEPINIONPINIONEDPINIONINGPINNIPEDPINTAILPINTOPIPITPIRANHAPITCHPITCHEDPITCHINGPLACENTALPLANARIAPLANARIANPLANKTONPLATEPLATYPIPLOVERPLUGPLUMEPLUMEDPOCKETPOINTPOLLPOLLACKPOLLARD*POLLENPOLLIWOGPOLLOCKPOLYPPOMPANOPONYPOOCHPORKYPOULTPOULTRYPOUNDPOUTPRANCINGPRAWNPRICKPRIONPRONGPRONGPUFFINPULIPULLETPUMAPUPAPUPAEPUPALPUPATEPUPPYPUPPYLIKEPURRPURRINGPYTHONQUEENQUILLRABBITRABIDRACCOONRACKRADIIRAFTRAILRAINBOWRANGYRAPACITYRAPTORRATTAILRATTRAPRATTYRAZORBACKREEVERHINORIBBITRIDINGROACHROANROARROARINGROBINROLLROOKROOTROUGHROYALRUFFRUMPRUNNINGRUNTRUNTYRUNTYSKUASKUASTABBYTAILTAILFIN*TALONTAMARINTAMETAMEDTAMELYTAMINGTANGTANNINGTAPIRTARANTULATEALTEAMTEATTEETHTELLTALETEMPLETENTTENTACLETHIGHTHORACICTHORNTHROWTHROWNTHYROIDTIBIATIBIAETIBIALTICKTICKINGTILAPIATINETITMICETOADTOCKTOEDTOMCATTOMTITTONGUETONGUEDTOOTHTOPETOPKNOTTOROTORPORTOUCANTOWHEETOWNTRACKTRACKWAYTRICOLORTRITONTRODTROOPTROUTTUFTTUFTEDTUNATUNNELTURBOTTWEETTWEETEDTWINTWINNINGTYPETYPHOIDULNAULNAEULNARUNFLEDGEDUNGULATEUNHUMANUNHUMANLYUNWEANEDVAGINAVAGINALVAGRANTVALVEVANEVARMINTVEALVEILVEINVEINEDVEININGVELUMVELVETVENTVIRGINVOLANTVOLEVULPINEWAHOOWAIFWALKWALLAROOWALLEYEWALLOWWALLOWEDWALLOWINGWARTHOGWATTLEWAVEWEANWEANEDWEANINGWEAVEWEAVINGWEBBEDWHALEWHELPWHINNIEDWHINNYWHINNYINGWHIPPOORWILLWHITEWHITINGWHOOPWHOOPINGWHORLWILDCATWILDLINGWILTWINGWINGEDWINGINGWINKLEWOLFWOODCOCKWOOFWOOFEDWOOFINGWOOLWORMWORRYWRACKYAKSYAPPEDYAPPYYARDYEAN*YELPYELPEDYIPPINGYOLKYOLKYYOUNGYOWLZOOLOGICZOOLOGICAL