LexiTopic: Places and Spaces
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to PLACES AND SPACES in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to PLACES AND SPACES
SUBJECT HEADINGS IN THIS LEXITOPIC:
Closed, Closing, BarringConcealed, Covered, HiddenCourse and Direction general; not maps, not travelEdges, Boundaries, Abutments not mapsEmitting, EjectingEmpty, Emptying, EmptinessEnclosures, Confinements, Captivity including releaseFull, Filling, FullnessHoles and Hollows spaces and places, not containersInside and Outside not indoors or outdoorsLocation within a broad areaOpen, Opening, AdmittingParticular PlacesPosition general, of an object, person, etc.Proximity relative distance; near and farRevealed, Uncovered, VisibleSlopes and Slants includes level, unlevelStorage Places and Spaces not furniture, not containersSurrounding, SurroundingsUps and Downs words about high and low
NOTES ABOUT THE TAXONOMY FOR PLACE
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to places and spaces, including the relative positions of things and materials in or out of places and spaces, how places and spaces conceal or reveal what is in them, etc.
Words related to measurements of place (distance, length, height, etc.) are in MEASURES AND MEASUREMENTS.
Words related to maps, charts, etc., are in GEOLOGY AND GEOGRAPHY.
Words related to cities, towns, counties, etc., are in GOVERNMENT, CIVICS, AND POLITICS.
Words related to interior and exterior spaces of buildings are in BUILDINGS AND ARCHITECTURE.
Words related to furniture used for storage are in FURNISHINGS AND FITMENTS.
Words related to containers and packaging are in MANUFACTURING, PRODUCTS, AND PACKAGING.
Topical arrangement of Spelling Bee words related to PLACES AND SPACES
Closed, Closing, Barring
BANNED: to bar entry; to keep out, to excludeBANNING: to bar entry; to keep out, to excludeBARRING: to place bars across to prevent ingress or egressBUTTON: to close or seal tightly —usually used with upBUTTONED: to close or seal tightly —usually used with upBUTTONING: to close or seal tightly —usually used with upCAPPED: to provide or protect with a cap (cap a bottle)CAPPING: to provide or protect with a cap (cap a bottle)PLUG: a piece used to fill a hole: a stopper; also, an obtruding or obstructing mass of material resembling a stopper also, to stop, make tight, or secure by inserting a plug; to remedy (a deficiency) as if by inserting a plug (trying to plug the gaps in their understanding); also, to become plugged —usually used with upTIGHT: also, (adv.) fast, tightly, firmly (the door was shut tight); also, so close in structure as to prevent passage or escape (as of liquid, gas, or light) (a tight ship, a tight seal)TIGHTEN: re: having elements close together (a tight formation): to make tight or tighter; to become tight or tighterTIGHTENING: re: having elements close together (a tight formation): to make tight or tighter; to become tight or tighterTIGHTLY: also, (adv.) fast, tightly, firmly (the door was shut tight); also, so close in structure as to prevent passage or escape (as of liquid, gas, or light) (a tight ship, a tight seal)TOPPED: to cover with a top or on the top: to provide, form, or serve as a top forTOPPING: to cover with a top or on the top: to provide, form, or serve as a top forUNOPEN: (adj) not open: closed, shut, sealedUNOPENED: (adj) not opened (unopened mail, an unopened window, a letter that was returned unopened)ZIPPED: to close or open with or as if with a zipper; to enclose or wrap by fastening a zipper; to cause (a zipper) to open or shut; to become open, closed, or attached by means of a zipper
Concealed, Covered, Hidden
BACKROOM: made or operating in an inconspicuous way: behind-the-scenes [M-W has the open compound back room for a room situated in the rear, or the meeting place of a directing group that exercises its authority in an inconspicuous and indirect way]BLANKET: something that resembles a blanket (a blanket of fog); to cover with or as if with a blanket; to cover so as to obscure, interrupt, suppress, or extinguishBLIND: something to hinder sight; also, a place of concealment; also, difficult to discern, make out, or discover; hidden from sight: covered; also, to hide, conceal (the trail blinded by snow)BLINDING: to hide, conceal (the trail blinded by snow)BLOCK: to shut off from view (The building blocks our view of the ocean.)BLOCKED: to shut off from view (The building blocks our view of the ocean.)BLOCKS: to shut off from view (The building blocks our view of the ocean.)BURY: to cover from view (buried her face in her hands, car buried under the snow); to conceal in obscurity (buried the retraction among the classified ads)CLOAK: something that envelops or conceals (a cloak of secrecy); also, to cover or hide with or as if with a cloakCLOAKED: to cover or hide with or as if with a cloakCONCEAL: to place out of sightCOPE: something resembling a cope (as by concealing or covering) (the dark sky's starry cope); to cover or furnish with a copeCOPED: something resembling a cope (as by concealing or covering) (the dark sky's starry cope); to cover or furnish with a copeCURTAIN: a device or agency that conceals or acts as a barrier; also, also, to furnish with or as if with curtains; to veil or shut off with or as if with a curtainDOGGO: in hiding to avoid notice or detection —used chiefly in the phrase lie doggoDROP: to pass from view or notice: disappear (drop out of sight)DROPPING: to pass from view or notice: disappear (drop out of sight)FADE: to change gradually in loudness, strength, or visibilityFADED: to change gradually in loudness, strength, or visibilityFADING: to change gradually in loudness, strength, or visibilityHIDDEN: being out of sight or not readily apparent: concealed; also, to put out of sight: secrete (hide a key under the doormat); to conceal for shelter or protection: to shield (They hid him from the police.); to screen from or as if from view: to obscure (clouds hiding the sun); to remain out of sight (She hid under the bed.)HIDE: to put out of sight: secrete (hide a key under the doormat); to conceal for shelter or protection: to shield (They hid him from the police.); to screen from or as if from view: to obscure (clouds hiding the sun); to remain out of sight (She hid under the bed.)HIDING: to put out of sight: secrete (hide a key under the doormat); to conceal for shelter or protection: to shield (They hid him from the police.); to screen from or as if from view: to obscure (clouds hiding the sun); to remain out of sight (She hid under the bed.)LURK: to lie in wait in a place of concealment especially for an evil purpose; to be concealed but capable of being discovered, specifically: to constitute a latent threat; to move furtively or inconspicuously; to lie hidden; also, to persist in stayingLURKING: to lie in wait in a place of concealment especially for an evil purpose; to be concealed but capable of being discovered, specifically: to constitute a latent threat; to move furtively or inconspicuously; to lie hidden; also, to persist in stayingLYING: to lie: to remain inactive (as in concealment) (lie in wait)MANTLE: to cover with or as if with a mantle: to cloak; to become covered with a coating; to spread over a surface (mantled with snow); also, something that covers, enfolds, or envelops (a mantle of snow)OCCLUDE: to conceal (cosmetics that occlude pores)OCCLUDED: to conceal (cosmetics that occlude pores)OCCULT: hidden from view: concealed (occult underground passages); also, to shut off from view or exposure: to cover, eclipse
OVER: so as to cover the whole surface (windows boarded over)PALL: something that covers or conceals; also, to cover with a pall: to drapePALLED: something that covers or conceals; also, to cover with a pall: to drapePALLING: something that covers or conceals; also, to cover with a pall: to drapePALM: to conceal in or with the hand (palm a card)PALMED: to conceal in or with the hand (palm a card)PANOPLY: something forming a protective covering (a panoply of smoke)PHANTOM: something apparent to sense but with no substantial existence: an apparition; something elusive or visionary; something existing in appearance only; of the nature of, suggesting, or being a phantom: illusoryPLANT: to conceal; to covertly place for discovery, publication, or disseminationTARP: a piece of material (such as durable plastic or waterproofed canvas) used especially for protecting exposed objects or areas: a tarpaulinTUCK: to put into a snug often concealing or isolating place (a cottage tucked away in the hill)TUCKED: to put into a snug often concealing or isolating place (a cottage tucked away in the hill)UNDETECTED: not observed, noticed, or detectedUNFOUND*: not found: remaining unknown: undiscoveredUNNOTED: not noted: unobserved, disregardedVEIL: a concealing curtain or cover of cloth; also, something that resembles a veil (a veil of stars), especially: something that hides or obscures like a veil (lift the veil of secrecy); also, to cover, provide, obscure, or conceal with or as if with a veil; to put on or wear a veilVEILED: obscured as if by a veil: disguised (veiled threats): a concealing curtain or cover of cloth; also, something that resembles a veil (a veil of stars), especially: something that hides or obscures like a veil (lift the veil of secrecy); also, to cover, provide, obscure, or conceal with or as if with a veil; to put on or wear a veilVEILING: a concealing curtain or cover of cloth; also, something that resembles a veil (a veil of stars), especially: something that hides or obscures like a veil (lift the veil of secrecy); also, to cover, provide, obscure, or conceal with or as if with a veil; to put on or wear a veilWAIT: a hidden or concealed position —used chiefly in the expression lie in waitWINK: to avoid seeing or noting something —usually used with at (winked at minor transgressions)WINKING: to avoid seeing or noting something —usually used with at (winked at minor transgressions)WOODWORK: a place or state of concealment, seclusion, or anonymity (witnesses came out of the woodwork when a reward was offered)WRAP: to conceal or obscure as if by envelopingWRAPPING : to conceal or obscure as if by enveloping
Course and Direction general; not maps, not travel
ALONG: preposition: in a line matching the length or direction of; also: at a point or points on (e.g., a house along the river); also, in the course of (e.g., made stops along the way)ATHWART: across; across especially in an oblique directionAWRY: off the correct or expected course: amissAXIAL: of, relating to, or having the characteristics of an axis, or situated around, in the direction of, on, or along an axis, a main line of direction, motion, growth, or extension (the axis of a city)AXIALLY: of, relating to, or having the characteristics of an axis, or situated around, in the direction of, on, or along an axis, a main line of direction, motion, growth, or extension (the axis of a city)BACK: to have the rear part facing in the direction of something; also, the side or surface opposite the front or face; the rear part (e.g., the back of the head, the back of the mirror); a place away from the front; to, toward, or at the rear; being at or in the back (back door)BACKWARD: toward the back or rear; with the back foremost; in a reverse or contrary direction or wayBELOW: south of (located 20 miles below the nation's capital)CHANGE: to give a different position, course, or direction to (changed his route)CHANGED: to give a different position, course, or direction to (changed his route)CHANGING: to give a different position, course, or direction to (changed his route)DEAD: directly (dead ahead)DIAGONAL: a diagonal direction; something oriented in diagonal positionGOING: present participle of to go, to extend from point to point or in a certain direction (The road goes to the lake.)GONE: past participle of to go, to extend from point to point or in a certain direction (The road goes to the lake.)HAND: side, direction (people dancing on either hand)INCLINE: to deviate from a line, direction, or course INCLINED: to deviate from a line, direction, or course INCLINING: to deviate from a line, direction, or course LAID: to have direction: to extend (the route lay to the west)LAIN: to have direction: to extend (the route lay to the west)LEAD: to direct on a course or in a direction (a road leading the traveler to the heart of the city); to lie, run, or open in a specified place or direction (path leads uphill)LEFT: the location or direction of the left side or the part on the left side; located on the left of an observer facing in the same direction as the object specified (stage left, the left arm of a chair); also, a turn to the left (take a left at the intersection)LINE: the course or direction of something in motion: route (the line of flight of a bird)LOOK: to have a specified outlook (the house looked east)LOOKED: to have a specified outlook (the house looked east)LYING: to have direction: to extend (the route lay to the west)MADE: to reach or extend in a certain direction (The forest makes up nearly to the snow line.)MAKE: to reach or extend in a certain direction (The forest makes up nearly to the snow line.)MAKING: to reach or extend in a certain direction (The forest makes up nearly to the snow line.)MARK: to plot the course of: to chartMAZE: a confusing intricate network of passagesNORTH: the direction of the north terrestrial pole: the direction to the left of one facing east; the compass point directly opposite to south; also, to, toward, or in the north; situated toward or at the north (the north entrance); coming from the north (a north wind)OUTBOUND: outward boundPATH: a course, route (the path of a meteor)PLUMP: straight down, straight aheadPOINT: a direction indicated by a compass point (from all points of the compass); also, to cause to be turned in a particular direction; also, to lie extended, aimed, or turned in a particular direction (a directional arrow that pointed to the north)POINTING: a direction indicated by a compass point (from all points of the compass); also, to cause to be turned in a particular direction; also, to lie extended, aimed, or turned in a particular direction (a directional arrow that pointed to the north)PRICK: to become directed upward: to pointRANGING: to correspond in direction or line: to align; to extend in a particular directionRIGHT: straight (a right line); in a direct line, course, or manner: directly, straight (go right home) (came right out and said it)RUNNING: to lie in or take a certain direction (the boundary line runs east); —sometimes used figuratively (My tastes in books run to/toward science fiction.)TEND: to move, direct, or develop one's course in a particular direction (cannot tell where society is tending)TENDED: to move, direct, or develop one's course in a particular direction (cannot tell where society is tending)THATAWAY: in that direction; alteration of that wayTHROUGH: used as a function word to indicate movement into something at one side or point and out at another and especially the opposite side of; by way of (she came in through the side door); used as a function word to indicate passage from one end or boundary to another (a highway through the forest) —used as a function word to indicate movement within a place or area of land, air, etc. (flew through the air)TRAIN: to aim at an object or objective: to direct (trained his camera on the bird)TURN: to direct or point (something, such as the face) in a specified way or direction (turned her face towards the camera); to present by a change in direction or position (turning his back to the audience); to cause to go in a particular direction (turned our steps homeward); to bring into alignment (as by aiming, pointing, or focusing) with an object or objective: to train (turned the light into the dark doorway, turned a questioning eye on to her); to direct one's course (turned to the right/left); to take a different course or direction (turned toward home, the main road turns sharply to the right); to change position (as of one's head) so as to face another way (everyone turned to stare); to face toward or away from someone or something (flowers turn toward the light); to set in another especially contrary direction; to bend or change the course of: to divert (turned the ship towards shore); to bend a course around or about: to round (turned the corner at full speed)UNTO: used as a function word in many different expressions concerning place, course, and directionWENT: past tense of to go, to extend from point to point or in a certain direction (The road goes to the lake.)WIND: a direction from which the wind may blow: a point of the compass, especially: one of the cardinal points; also, the direction from which the wind is blowingWINDWARD: the side or direction from which the wind is blowing; being in or facing the direction from which the wind is blowing
Edges, Boundaries, Abutments not maps
ABUT: to border on: to touch along an edgeADJACENCY: something that is adjacent; the quality or state of being adjacent: contiguityBOUND: a limiting line: a boundary —usually used in plural (The ball landed out of bounds.); to form a separating line or the boundary of: to enclose (A chain-link fence bounds the yard.) (The state is bounded on its east by the Connecticut River.)BOUNDED: a limiting line: a boundary —usually used in plural (The ball landed out of bounds.); to form a separating line or the boundary of: to enclose (A chain-link fence bounds the yard.) (The state is bounded on its east by the Connecticut River.)BUTT: to abut —used with on or against (floorboards butt against each other); also, to place end to end or side to side without overlapping (butt the boards together)BUTTED: to abut —used with on or against (floorboards butt against each other); also, to place end to end or side to side without overlapping (butt the boards together)BUTTING: to abut —used with on or against (floorboards butt against each other); also, to place end to end or side to side without overlapping (butt the boards together)CIRCUIT: a usually circular line encompassing an area (a swamp about 10 miles in circuit), or the space enclosed within such a line (the circuit of the duke's land)CONTACT: a union or junction of surfaces; also, to make contact or to bring into contact; also, (adj) maintaining, involving, or activated or caused by contact (contact dermatitis)DEFINE: to fix or mark the limits of: to demarcate (rigidly defined property lines)DEFINED: to fix or mark the limits of: to demarcate (rigidly defined property lines)DEFINING: to fix or mark the limits of: to demarcate (rigidly defined property lines)EDGE: the line where an object or area begins or ends: a border (on the edge of the sea); also, the narrow part adjacent to a border (the edge of the deck); also, to be on an edge of (trees edging the lake)EDGED: the line where an object or area begins or ends: a border (on the edge of the sea); also, the narrow part adjacent to a border (the edge of the deck); also, to be on an edge of (trees edging the lake)EDGING: the line where an object or area begins or ends: a border (on the edge of the sea); also, the narrow part adjacent to a border (the edge of the deck); also, to be on an edge of (trees edging the lake)LAID: to bring against or into contact with something: apply (laid the watch to his ear)LAPPED: to place over and cover a part of: to overlap (lap shingles on a roof); also, to project beyond or spread over something; to lie partly over or alongside of something or of one another: to overlapLAPPING: to place over and cover a part of: to overlap (lap shingles on a roof); also, to project beyond or spread over something; to lie partly over or alongside of something or of one another: to overlapLAYING: to bring against or into contact with something: apply (laid the watch to his ear)LIMIT: limits plural: the place enclosed within a boundary: bounds (the limits of his imagination)LINE: a boundary of an area (the state line)MARGIN: the outside limit and adjoining surface of something; the edge (at the margin of the woods)NEXT: immediately adjacent (as in place, rank, or time); in the time, place, or order nearest or immediately succeeding; nearest or adjacent to
OVER: forward beyond an edge or brink and often down (wandered too near the cliff and fell over); across the brim (soup boiled over)RIDING: to project over: to overlapRIMMING: to serve as a rim for: to border (cliffs rimming the camp); also, to form or show a rim
Emitting, Ejecting
CAME: to issue forth (A sob came from her throat.)COME: to issue forth (A sob came from her throat.)COMING: to issue forth (A sob came from her throat.)EJECT: to throw out or off from withinEJECTABLE: to throw out or off from withinEJECTED: to throw out or off from withinEJECTION: to throw out or off from withinEMANANT*: issuing or flowing forth: emerging from or as if from a sourceEMANATE: emit (she seems to emanate an air of serenity); to come out from a source (a sweet scent emanating from the blossoms)EMIT: to send out: to ejectEMITTED: to send out: to ejectEMITTING: to send out: to ejectEVICT: to force out: to expelEVICTED: to force out: to expelEVICTION: to force out: to expelEVOLVE: to emitEVOLVED: to emitEVOLVING: to emitEXPEL: to force out: to eject (expelled the smoke from her lungs)POKE: to cause to project (poked her head out of the window); to become stuck out or forward: to protrudeROUT: to drive out: dispelVOID: discharge, emitVOIDED: discharge, emitVOLLEY: a burst or emission of many things or a large amount at once (received a volley of angry letters); also, to discharge in or as if in a volley; to become discharged in or as if in a volleyVOMIT: to spew forth: belch, gush; to eject violently or abundantly: spew
Empty, Emptying, Emptiness
BAIL: a container used to remove water from a boat; or the act of removing water from a boatBAILING: a container used to remove water from a boat; or the act of removing waterCLEAN: empty (the ship returned with a clean hold); also, to strip, to empty (a tree cleaned of fruit)CLEANED: empty (the ship returned with a clean hold); also, to strip, to empty (a tree cleaned of fruit)CLEANING: empty (the ship returned with a clean hold); also, to strip, to empty (a tree cleaned of fruit)DEPLETE: to empty of a principal substanceDEPLETED: to empty of a principal substanceDIPPED: to withdraw a part of the contents of something by or as if by reaching down inside it —used with into (dipped into his pocket for change, dipped into the family's savings); to lift a portion of by reaching below the surface with something shaped to hold liquid: to ladleDIPPING: to withdraw a part of the contents of something by or as if by reaching down inside it —used with into (dipped into his pocket for change, dipped into the family's savings); to lift a portion of by reaching below the surface with something shaped to hold liquid: to ladleDRAIN: a gradual outflow or withdrawal: depletion; also, something that causes depletion: a burden (a drain on the city's resources); also, to cause the gradual disappearance of (drain the region's wealth); also, to deplete or empty by or as if by drawing off by degrees or in increments (drained the country of its resources); to disappear gradually: to dwindle (his happiness drained away)DRAINING: a gradual outflow or withdrawal: depletion; also, something that causes depletion: a burden (a drain on the city's resources); also, to cause the gradual disappearance of (drain the region's wealth); also, to deplete or empty by or as if by drawing off by degrees or in increments (drained the country of its resources); to disappear gradually: to dwindle (his happiness drained away)EMPTIED: containing nothing; also, to make empty: remove the contents of (empty a purse); to become empty (the theater emptied quickly); to discharge (itself) of contents; to discharge contents (the river empties into the ocean); to remove from what holds or enclosesEMPTY: (noun) something (such as a bottle or can) that is empty; also, containing nothing; also, to make empty: remove the contents of (empty a purse); to become empty (the theater emptied quickly); to discharge (itself) of contents; to discharge contents (the river empties into the ocean); to remove from what holds or enclosesLEACH: to draw out or remove as if by percolation (all meaning has been leached from my life)LEACHED: to draw out or remove as if by percolation (all meaning has been leached from my lifeOOZE: to exude, to diffuse (ooze confidence); to emit slowlyOOZED: to exude, to diffuse (ooze confidence); to emit slowlyOOZING: to exude, to diffuse (ooze confidence); to emit slowlyOUTPOUR: an outpouring; also, to pour outPOUR: an instance of pouring or an amount poured; also, to dispense from a containerPOURING: an instance of pouring or an amount poured; also, to dispense from a containerROBBING: to take the contents of (a receptacle) (rob a hive of honey, rob the cookie jar)TAKE: to remove (take eggs from a nest)TAKEN: to remove (take eggs from a nest)TAPPED: to let out or cause to flow by piercing or by drawing a plug from the containing vessel (tap wine from a cask); to pierce so as to let out or draw off a fluid (tap maple trees)TAPPING: to let out or cause to flow by piercing or by drawing a plug from the containing vessel (tap wine from a cask); to pierce so as to let out or draw off a fluid (tap maple trees)TEEM: to empty, to pour [into, to fill] (teem molten metal into a mold)TEEMED: to empty, to pour [into, to fill] (teem molten metal into a mold)TEEMING: to empty, to pour [into, to fill] (teem molten metal into a mold)TOOK: to remove (take eggs from a nest)TURN: to convey or direct out of an inverted receptacle (turn the mixture into a baking dish)UNBAG: to pour, take, or let go out of a bagUNBAGGING: to pour, take, or let go out of a bagUNBOX: to remove from a boxUNBOXING: to remove from a boxUNCAP: to remove a cap or covering fromUNCLOG: to remove a clog; to free from a difficulty or obstructionUNCLOGGING: to remove a clog; to free from a difficulty or obstructionUNJAM: not in M-W or NOAD; Collins has in British English, to remove a blockage from (a machine, printer, shredder, etc.)UNJAMMING: not in M-W or NOAD; Collins has in British English, to remove a blockage from (a machine, printer, shredder, etc.)
Enclosures, Confinements, Captivity including release
ANGLE: a partially enclosed spaceANGLED: [of or related to] a partially enclosed spaceBOTTLE: to put or keep in a position or situation that makes free activity, progress, or escape difficult or impossible —usually used with up (bottle up legislation in committee)BOUND: something that limits or restrains; also, to set limits to: to confine BOUNDED: something that limits or restrains; also, to set limits to: to confine BOXING: to hem in (someone, such as an opponent) —usually used with in, out, or up (boxed out the tackle) (boxed in, in traffic)CAGE: a box or enclosure having some openwork for confining or carrying animals (such as birds); also, to confine or keep in or as if in a cageCAGED: a box or enclosure having some openwork for confining or carrying animals (such as birds); also, to confine or keep in or as if in a cageCAGING: a box or enclosure having some openwork for confining or carrying animals (such as birds); also, to confine or keep in or as if in a cageCAPTIVITY: the state of being captiveCAPTOR: one that has captured a person or thingCONFINE: confines plural: something (such as borders or walls) that encloses (outside the confines of the office); also, to hold within a location; to keep within limitsCONFINED: to hold within a location; to keep within limitsCONFINING: to hold within a location; to keep within limitsCONTAIN: to keep within limits: to restrain, to control; to enclose, bound; to have within: to hold; to comprise, to includeCOPPED: slang: to get hold of: catch, captureCOPPING: slang: to get hold of: catch, captureCRAMP: something that confines: shackle; also, the state of being confined; also, to confine, restrain (cramped in the tiny apartment); being cramped (a cramp corner)CRANNY: an obscure nook or cornerENCAGE: to cage, to confine or keep in or as if in a cageENCAGED: to cage, to confine or keep in or as if in a cageENCAGING: to cage, to confine or keep in or as if in a cageENLACE: to encircle, to enfoldENLACED: to encircle, to enfoldENLACING: to encircle, to enfoldespecially: something that acts as a barrier or defense (a wall of reserve); also, to immure, to enclose within or as if within wallsespecially: something that acts as a barrier or defense (a wall of reserve); also, to immure, to enclose within or as if within wallsespecially: something that acts as a barrier or defense (a wall of reserve); also, to immure, to enclose within or as if within wallsFENCE: a barrier intended to prevent escape or intrusion or to mark a boundary; also, to enclose with a fence; to keep in or out with a fenceFENCED: a barrier intended to prevent escape or intrusion or to mark a boundary; also, to enclose with a fence; to keep in or out with a fenceFENCING: a barrier intended to prevent escape or intrusion or to mark a boundary; also, to enclose with a fence; to keep in or out with a fenceGUARD: to watch over so as to prevent escape, disclosure, or indiscretion (guarded the prisoners); to stand at the entrance of as if on guard or as a barrierGUARDING: to watch over so as to prevent escape, disclosure, or indiscretion (guarded the prisoners); to stand at the entrance of as if on guard or as a barrierHEDGE: to confine so as to prevent freedom of movement or action: to obstruct with or as if with a barrier; also, a fence or boundary formed by a dense row of shrubs or low trees; to enclose or protect with or as if with a dense row of shrubs or low trees; to enclose or protect with or as if with a hedge; to encircle (homes hedged with boxwoods)HEDGED: to confine so as to prevent freedom of movement or action: to obstruct with or as if with a barrier; also, a fence or boundary formed by a dense row of shrubs or low trees; to enclose or protect with or as if with a dense row of shrubs or low trees; to enclose or protect with or as if with a hedge; to encircle (homes hedged with boxwoods)HEDGING: to confine so as to prevent freedom of movement or action: to obstruct with or as if with a barrier; also, a fence or boundary formed by a dense row of shrubs or low trees; to enclose or protect with or as if with a dense row of shrubs or low trees; to enclose or protect with or as if with a hedge; to encircle (homes hedged with boxwoods)HELD: to enclose, to contain, to accommodateHOLD: to enclose, to contain, to accommodateLAIR: a refuge or place for hidingLIMIT: something that bounds, restrains, or confines; also, to restrict the bounds or limits of; also, to assign certain limits to: to prescribeMANUMIT: to release from slaveryMEWED: to shut up: to confine —often used with upMEWING: to shut up: to confine —often used with upNAIL: to catch, to trapNAILING: to catch, to trapNETTED: to catch in or as if in a netNETTING: to catch in or as if in a netPALE: an area or the limits within which one is privileged or protected (as from censure) (conduct that was beyond the pale); also, a space or field having bounds: an enclosure (The cattle were led into the pale.)PATCH: a part or area distinct from that about it (a cabbage patch)PAWN: a hostagePENNED: to shut in or as if in a penPENNING: to shut in or as if in a penPENT: shut up: confined (a pent crowd)POUND: a place or condition of confinementRADII: plural of radius, a bounded or circumscribed areaTAKE: to lay hold: to catch, hold; to seize or capture physically (took them as prisoners)TAKEN: to lay hold: to catch, hold; to seize or capture physically (took them as prisoners)TIGHT: allowing little or no room for free motion or movement (a tight connection, a tight crawl space); also: having a small radius (a tight turn)TIGHTLY: allowing little or no room for free motion or movement (a tight connection, a tight crawl space); also: having a small radius (a tight turn)TOOK: to lay hold: to catch, hold; to seize or capture physically (took them as prisoners)TRAP: something by which one is caught or stopped unawares; also: a position or situation from which it is difficult or impossible to escape; also, to place in a restricted position: to confine; to stop, to hold; to provide or set (a place) with traps; to catch or take in or as if in a trap: to entrapUNBIND: not bound: not confined; to set free: to releaseUNBINDING: not bound: not confined; to set free: to releaseUNBOUND: not bound: not confined; to set free: to releaseUNBOUNDED: unrestrained, uncontrolledUNCAGING: to release from or as if from a cage: to free from restraintUNFENCED: not enclosed or bordered by a fence: not fenced (an unfenced pasture/garden/yard)UNLOCK: to free from restraints or restrictions (The shock unlocked a flood of tears.); also, to become unfastened or freed from restraintsUNPEN: to release from a pen or from confinementUNPENNED: not confined by a pen; also, to release from a pen or from confinementUNPENNING: Not in M-W (though M-W has unpen and unpenned, to release from a pen or from confinement); Collins has unpenning, to release from confinementWALL: something resembling a wall (as in appearance, function, or effect), WALLED: something resembling a wall (as in appearance, function, or effect), WALLING: something resembling a wall (as in appearance, function, or effect), WARD: the state of being under guard, especially custody: the immediate charge and control (as over a ward or a suspect) exercised by a person or an authority; also, a person or thing under guard, protection, or surveillance: such as a minor subject to wardship; a person who by reason of incapacity (such as minority or mental illness) is under the protection of a court either directly or through a guardian appointed by the court, called also ward of court; also, a person or body of persons under the protection or tutelage of a government; also, the action or process of guarding; also, a body of guards; also, to keep watch over: to guardWARDING: the state of being under guard, especially custody: the immediate charge and control (as over a ward or a suspect) exercised by a person or an authority; also, a person or thing under guard, protection, or surveillance: such as a minor subject to wardship; a person who by reason of incapacity (such as minority or mental illness) is under the protection of a court either directly or through a guardian appointed by the court, called also ward of court; also, a person or body of persons under the protection or tutelage of a government; also, the action or process of guarding; also, a body of guards; also, to keep watch over: to guardWITHIN: enclosed; also, —used as a function word to indicate enclosure or containmentWOMB: a cavity or space that resembles a womb in containing and enveloping
Full, Filling, Fullness
BAGGED: to put into a bagBAGGING: to put into a bagBELLIED: to swell or fillBELLY: to swell or fillBLOAT: to fill to capacity or overflowingBRIM: verb: to fill to the brimCAKE: to fill (a space) with a packed massCAKED: to fill (a space) with a packed massCAKING: to fill (a space) with a packed massCHARGING: to load or fill to capacity; to fill or furnish fullyCHOCK: a wedge or block for filling in an unwanted spaceCHOKE: to fill completelyCHOKING: to fill completelyCLOG: to fill beyond capacity: to overload (cars clogged the main street); —often used with up (petty cases clogging up the courts); to become filled with extraneous matter —often used with up; to unite in a mass: to clotCLOGGING: to fill beyond capacity: to overload (cars clogged the main street); —often used with up (petty cases clogging up the courts); to become filled with extraneous matter —often used with up; to unite in a mass: to clotCRAM: to pack tight: to jamCRAM: to thrust in or as if in a rough or forceful manner (crammed the letters into his pocket)FEED: to insert and deposit something into (something), especially to do so repeatedly or continuously (feed quarters into a parking meter)FEEDING: to insert and deposit something into (something), especially to do so repeatedly or continuously (feed quarters into a parking meter)FILL: something that fills: such as material used to fill a receptacle, cavity, passage, or low place; to put into as much as can be held or conveniently contained; to become full; to occupy the whole of; to make full; to spread through (music filled the air) FILLABLE: not in M-W; Collins has “in British English” able to be filled: something that fills: such as material used to fill a receptacle, cavity, passage, or low place; to put into as much as can be held or conveniently contained; to become full; to occupy the whole of; to make full; to spread through (music filled the air) FILLED: something that fills: such as material used to fill a receptacle, cavity, passage, or low place; to put into as much as can be held or conveniently contained; to become full; to occupy the whole of; to make full; to spread through (music filled the air)FILLING: something that fills: such as material used to fill a receptacle, cavity, passage, or low place; to put into as much as can be held or conveniently contained; to become full; to occupy the whole of; to make full; to spread through (music filled the air)FITTED: to make a place or room for: to accommodate (She fit all of the books into a single box.); to be accommodated (Will we all fit into the car?)FITTING: to make a place or room for: to accommodate (She fit all of the books into a single box.); to be accommodated (Will we all fit into the car?)FLOWN: filled to excessFULL: containing as much or as many as is possible or normalGOING: present participle of to go, to be capable of passing, extending, or being contained or inserted (Will these clothes go in your suitcase?)GONE: past participle of to go, to be capable of passing, extending, or being contained or inserted (Will these clothes go in your suitcase?)INFILL: material that fills in something (such as a hole)INFILLED: material that fills in something (such as a hole)INFILLING: material that fills in something (such as a hole)INJECT: to introduce [a substance] into something forcefullyINJECTED: to introduce [a substance] into something forcefullyINJECTION: an act or instance of injectingINPUT: an amount put in (increased input of fertilizer increases crop yield)JAMMING: to fill often to excess: to pack (the crowd jammed the theater); to become blocked, wedged, or stuck fast (The line jammed and the boat hung useless.)LINE: to put something in the inside of; to fillLINED: to put something in the inside of; to fillLINING: to put something in the inside of; to fillPACK: to fill completely (fans packed the stadium); to put in a container (goods packed for shipment)PACKED: filled to capacity (played to a packed house); also, to fill completely (fans packed the stadium); to put in a container (goods packed for shipment)PLENA: Not in M-W, but in Collins: plural of plenum: the quality or state of being full; also, a space or all space every part of which is full of matterPLENUM: the quality or state of being full; also, a space or all space every part of which is full of matterPLUG: a piece used to fill a hole: a stopper; also, to stop, make tight, or secure by inserting a plug; to remedy (a deficiency) as if by inserting a plug (trying to plug the gaps in their understanding); also, to become plugged —usually used with upPOCKET: to put or enclose in or as if in one's pocket (pocketed the change)PRIMING: to fill, to load; to put into working order by filling or charging with something (prime a pump with water)TAKE: to let in: admit (the boat was taking water fast); to accommodate (the suitcase wouldn't take another thing)TAKEN: to let in: admit (the boat was taking water fast); to accommodate (the suitcase wouldn't take another thing)TEEM: to empty, to pour [into, to fill] (teem molten metal into a mold)TEEMED: to empty, to pour [into, to fill] (teem molten metal into a mold)TEEMING: to empty, to pour [into, to fill] (teem molten metal into a mold)TIGHT: closely packed: very full (a tight bale of hay)TIGHTLY: closely packed: very full (a tight bale of hay)TOOK: to let in: admit (the boat was taking water fast); to accommodate (the suitcase wouldn't take another thing)TOPPED: to resupply or refill to capacity —usually used with off (topped off the tank)TOPPING: to resupply or refill to capacity —usually used with off (topped off the tank)WADDED: to form into a wad or wadding, especially: to roll or crush into a tight wad; to stuff or line with some soft substanceWADDING: wads or material for making wads; also, a soft mass or sheet of short loose fibers used for stuffing or padding; also, to form into a wad or wadding, especially: to roll or crush into a tight wad; to stuff or line with some soft substanceWEDGE: to force or press (something) into a narrow space: to cram; also, to become wedgedWEDGED: to force or press (something) into a narrow space: to cram; also, to become wedgedWEDGING: to force or press (something) into a narrow space: to cram; also, to become wedgedWENT: past tense of to go, to be capable of passing, extending, or being contained or inserted (Will these clothes go in your suitcase?)
Holes and Hollows spaces and places, not containers
BLANK: an empty or featureless place or space (a blank space, my mind was a blank)CLEFT: a space or opening made by or as if by splitting: a fissureCONCAVE: hollowed or rounded inward like the inside of a bowl; arched in: curving in; also, a concave line or surfaceCRANNY: a small break or slit: a creviceDENT: a depression or hollow made by a blow or by pressure; to make a dent inDENTED: a depression or hollow made by a blow or by pressure; to make a dent inDIVOT: a small dent: a small depression or hollowEXCAVATE: to form a cavity or hole in; to form by hollowing out; to dig out and remove; to expose to view by or as if by digging away a covering (excavate the remains of a temple); to make excavationsEXCAVATED: to form a cavity or hole in; to form by hollowing out; to dig out and remove; to expose to view by or as if by digging away a covering (excavate the remains of a temple); to make excavationsEYEHOLE: a hole or crevice to peep through [as in a mask]EYELET: a peephole or loopholeFLOOR: the lower inside surface of a hollow structure (such as a carton, cave or bodily part)GAPPY*: having, or characterized by, gapsGOUGE: the act of gouging; to scoop out with or as if with a gouge; also, a groove or cavity scooped outGOUGED: the act of gouging; to scoop out with or as if with a gouge; also, a groove or cavity scooped outGOUGING: the act of gouging; to scoop out with or as if with a gouge; also, a groove or cavity scooped outHOLE: an opening through something: perforation; an area where something is missing; a hollowed-out place; also, to make an opening through or a hollowed-out place in: to make a holeHOLED: to make a holeHOLEY: having holesHOLING: to make a holeHOLLOW: an unfilled space: cavity, hole; also, having an indentation or inward curve: concave, sunken; having an unfilled or hollowed-out space within; also, to remove the inside of: to make hollow; to form by hollowing; to become hollowHOLLOWING: to form by hollowing; to become hollowIMPRINT: a mark or depression made by pressure (e.g., the fossil imprint of a dinosaur's foot)INANE: a void or empty spaceINDENT: to force inward so as to form a depression; to form a dent inINDENTED: to force inward so as to form a depression; to form a dent inKNEEHOLE: an open space (as under a desk) for the kneesLACUNA: a blank space: a gapLACUNAL*: (adj) lacunary, of, relating to, or including lacunae, a lacuna being a blank space: a gapLOOPHOLE: a small opening to admit light and air or to permit observation; also, to make loopholes inPATENT: affording free passage: unobstructed (a patent opening)PATENTLY: affording free passage: unobstructed (a patent opening)PEEPHOLE: a hole or crevice to peep throughPINHOLE: a small hole made by, for, or as if by a pinPITTED: a hollow or indentation; also, to become marked with pits, especially: to preserve for a time an indentation made by pressurePITTING: a hollow or indentation; also, to become marked with pits, especially: to preserve for a time an indentation made by pressureRIFT: a clear space or interval (rifts in the clouds)ROOM: an extent of space occupied by or sufficient or available for somethingROOMY: having ample room: spaciousTAKE: to use up (space, time, etc.) (takes a long time to dry) (it takes up room)TAKEN: to use up (space, time, etc.) (takes a long time to dry) (it takes up room)TOOK: to use up (space, time, etc.) (takes a long time to dry) (it takes up room)VACANCY: empty space: void; the state of being vacant; vacuity, an empty spaceVACANT: being without content or occupant (a vacant seat on a bus)VOID: containing nothing (void space); empty space: emptiness, vacuum; a feeling of want or hollowness; an opening, a gap; also, to make empty or vacant: to clearVOIDED: containing nothing (void space); empty space: emptiness, vacuum; a feeling of want or hollowness; an opening, a gap; also, to make empty or vacant: to clearWELL: a space having a construction or shape suggesting a well for water
Inside and Outside not indoors or outdoors
BELLY: an internal cavity: interiorDEEP: extending well inward from an outer surface; also, extending well back from a surface accepted as front; also, extending far laterally from the center (deep borders of lace); also, having a specified extension in an implied direction usually downward or backward (a shelf 20 inches deep); situated well within the boundaries (a house deep in the woods)FLOOR: the lower inside surface of a hollow structure (such as a carton, cave or bodily part)INPUT: something that is put in; also, the act or process of putting inINWARD: situated on the inside: inner; directed toward the interiorLINE: to serve as the lining of (tapestries lined the walls)LINED: to serve as the lining of (tapestries lined the walls)LINING: to serve as the lining of (tapestries lined the walls)
OVER: outer, coveringRIGHT: of, relating to, or constituting the principal or more prominent side of an object (made sure the socks were right side out)TURN: to reverse the sides or surfaces of: to invert (turn pancakes, turn the shirt inside out)UNLINED: not lined: such as not having a lining or liner (an unlined coat, unlined fish ponds)WITHIN: in or into the interior: inside; also, to the inside of: into (within the earth); an inner place or area (revolt from within); being inside: enclosed (the within indictment); in or into the scope or sphere of (within the jurisdiction of the state)
Location within a broad area
ABROAD: over a wide area: widelyANYPLACE: in any place; anywhereAROUND: in or near one's present place or situation (e.g., waiting around for a while); here and there: from one place to another (e.g., she travels around on business); near (e.g., around Chicago, around the turn of the century) here and there in or throughout (e.g., barnstorming around the country)BACKYARD: a nearby area: neighborhoodCOUNTRY: rural as distinguished from urban areas (prefers the country to the city); also, of, relating to, or characteristic of the country (country living)ENDEMIC: restricted or peculiar to a locality or region (endemic diseases, an endemic species); belonging or native to a particular people or country; characteristic of or prevalent in a particular field, area, or environmentGLOBAL: of, relating to, or involving the entire world: worldwideGOING: present participle of to go, to give access: to lead to (That door goes to the cellar.)GONE: past participle of to go, to give access: to lead to (That door goes to the cellar.)LIEU: M-W’s only definition: archaic: place, steadLIVE: to be located or stored (the silverware lives in this drawer)LIVED: to be located or stored (the silverware lives in this drawer)LIVING: to be located or stored (the silverware lives in this drawer)LOCAL: characterized by or relating to position in space: having a definite spatial form or location; also, of, relating to, or characteristic of a particular place: not general or widespread; of, relating to, or applicable to part of a whole; also, primarily serving the needs of a particular limited district (local education programs)LOCALE: a place or locality especially when viewed in relation to a particular event or characteristic; also, site or scene (the locale of a story)LOCALLY: with respect to a particular place or situation; also, nearby; also, in the region of originLOCATE: to determine or indicate the place, site, or limits of (locate the lines of the property); also, to seek out and determine the location of (locate the source of the sound)LOCATOR: one that locates something (such as a mining claim or the course of a road)LOCI: plural of locus: the place where something is situated or occurs: site, locationLODGE: to serve as a receptacle for: to contain (a sinus lodging the nerve and artery of the part)LODGED: to serve as a receptacle for: to contain (a sinus lodging the nerve and artery of the part)MILIEU: the physical or social setting in which something occurs or develops: environmentNATAL: native: grown, produced, or originating in a particular place or in the vicinity: local (native fruits and vegetables)NATIVE: native: grown, produced, or originating in a particular place or in the vicinity: local (native fruits and vegetables); (noun) something indigenous to a particular localityNECK: region, part (my neck of the woods)NONLOCAL: not localNOOK: a secluded or sheltered place or partOUTDOOR: of or relating to the outdoors; outdoorsy: relating to, characteristic of, or appropriate for the outdoors; fond of the outdoors (an outdoor couple)
OVER: all through or throughout (showed me over the house, went over his notes, These trees once flourished over most of the area.)PART: a general area of indefinite boundaries —usually used in plural (you're not from around these parts) (took off for parts unknown)PLACE: a particular part of a surface or body: a spotPLOT: to locate (a point) by means of coordinatesPLOTTING: to locate (a point) by means of coordinatesPOCKET: a small often isolated area or group (pockets of unemployment)POINT: a particular place: locality (have come from distant points)POLAR: serving as a guide (a polar principle, a polar theory)POLE: a point of guidance or attractionRURAL: of or relating to the country, country people or life, or agricultureRURALLY: of or relating to the country, country people or life, or agricultureTHROUGH: over the whole surface or extent of: throughout (homes scattered through the valley)THROUGHOUT: all the way from one end to the other of: in or to every part of (cities throughout the United States); in or to every part : everywhere (of one color throughout)TOWN: the city or urban life as contrasted with the country (I’d rather live in town than in the country)TRACT: a defined area of landVENUE: a locale, a place or locality especially when viewed in relation to a particular event or characteristicVICINITY: a surrounding area or district: neighborhoodWENT: past tense of to go, to give access: to lead to (That door goes to the cellar.)WHENCE: from what place, source, or cause; from or out of which place, source, or causeWORK: to carry on an operation or perform a job through, at, in, or along (The salesman worked both sides of the street.) (a sportscaster hired to work the game)WORKING: to carry on an operation or perform a job through, at, in, or along (The salesman worked both sides of the street.) (a sportscaster hired to work the game)
Open, Opening, Admitting
ADHIBIT*: to let in (as a person or thing): bring inADMIT: to allow entry (as to a place, fellowship, or privilege)ADMITTED: to allow entry (as to a place, fellowship, or privilege)ADMITTING: to allow entry (as to a place, fellowship, or privilege)AJAR: slightly openCRACK: to open slightly (crack the door); also a narrow opening (leave the door open a crack.)GAGGED: to pry or hold open with a gagGAGGING: to pry or hold open with a gagINCOMING: coming in; also, the act of coming inINLET: a way of entering, especially: an opening for intakeINTO: used as a function word to indicate entry, introduction, insertion, superposition, or inclusionOPEN: an opening; also, to make an opening in (opened the boil); also, to move (something, such as a door) from a closed position; to make available for entry or passage by turning back (something, such as a barrier) or removing (something, such as a cover or an obstruction); also, to give access (the rooms open onto a hall)OPENABLE: an opening; also, to make an opening in (opened the boil); also, to move (something, such as a door) from a closed position; to make available for entry or passage by turning back (something, such as a barrier) or removing (something, such as a cover or an obstruction); also, to give access (the rooms open onto a hall)OPENED: an opening; also, to make an opening in (opened the boil); also, to move (something, such as a door) from a closed position; to make available for entry or passage by turning back (something, such as a barrier) or removing (something, such as a cover or an obstruction); also, to give access (the rooms open onto a hall)POPPED: to cause to explode or burst open (popped some popcorn, pop the trunk); to open with a pop (pop a cold beer)POPPING: to cause to explode or burst open (popped some popcorn, pop the trunk); to open with a pop (pop a cold beer)RIFT: to burst openRIFTING: to burst openUNBAN: to remove a ban or prohibition fromUNBANNED: to remove a ban or prohibition fromUNBANNING: to remove a ban or prohibition fromUNBAR: to remove a bar from: to unbolt, openUNBUTTON: to loose the buttons of; to open by or as if by loosing buttons; to undo buttonsUNBUTTONED: to loose the buttons of; to open by or as if by loosing buttons; to undo buttonsUNBUTTONING: to loose the buttons of; to open by or as if by loosing buttons; to undo buttonsUNCAP: to remove a cap or covering fromUNCLENCH: to open from a clenched position; to release from a grip: to become unclasped or relaxedUNCLENCHED: to open from a clenched position; to release from a grip: to become unclasped or relaxedUNLATCH: to become loosed or openedUNLOCK: open, undo (unlock the padlock) also, to become unfastened or freed from restraintsUNROOF*: to strip off the roof or covering ofUNZIP: to zip open; to open by or as if by means of a zipperUNZIPPED: to zip open; to open by or as if by means of a zipperWIDE: fully opened (wide-eyed)WINDOW: an opening (such as a shutter, slot, or valve) that resembles or suggests a windowWITHDRAW: to draw (something, such as a curtain) back or aside
Particular Places
AMBIANCE: variant of ambience, a feeling or mood associated with a particular place, person, or thing: atmosphereAMBIENCE: or ambiance, a feeling or mood associated with a particular place, person, or thing: atmosphereARCADIA: a region or scene of simple pleasure and quiet; named for Arcadia, region of ancient Greece frequently chosen as background for pastoral poetryARCADIAN: related to arcadia, a region or scene of simple pleasure and quiet; named for Arcadia, region of ancient Greece frequently chosen as background for pastoral poetryEDENIC*: M-W and NOAD capitalize Edenic: of or related to paradise, or to the garden where according to the account in Genesis Adam and Eve first lived, or a place of pristine or abundant natural beautyEDIFICE: a large abstract structure (the social edifice)HEAVEN: a place or condition of utmost happiness: something that is very pleasant or enjoyableHEAVENLY: delightfulHEDGE: born, living, or made alongside or as if alongside a dense row of shrubs or low trees: born, living, or made near or as if near hedges: roadside (hedge sparrows, a hedge parson)HELL: a place or state of misery, torment, or wickedness; a place or state of turmoil or destruction; an extremely unpleasant and often inescapable situationHELLHOLE: a place of extreme misery or squalorHOLE: a wretched or dreary placeHOOKY: to be away from school without permission; also: to be away from work or similar duties in a way likened to a child skipping schoolLAND: realm, domain (in the land of dreams; TV-land)LIMBO: an intermediate or transitional place or state; a place or state of neglect or oblivion; a place or state of restraint or confinementLIMINAL: of, relating to, or being an intermediate state, phase, or condition: in-between, transitionalMECCA: a place regarded as a center for a specified group, activity, or interest (a mecca for shoppers), named from Mecca, Saudi Arabia, a destination of pilgrims in the Islamic worldNIRVANA: a place or state of oblivion to care, pain, or external reality; a goal hoped for but apparently unattainable; a dreamPALE: an area or the limits within which one is privileged or protected (as from censure) (conduct that was beyond the pale)PLACE: a particular region, center of population, or location (a nice place to visit); a particular locationTEMPLE: a place devoted to a special purpose (a temple of cuisine)THENCE: from that placeZONAL: of, relating to, affecting, or having the form of a zone (a zonal boundary)ZONE: a region or area set off as distinct from surrounding or adjoining parts (an earthquake zone, a coastal zone); also, one of the sections of an area or territory created for a particular purpose or activity (a construction zone, lives in a different time zone); also, zonal: of, relating to, affecting, or having the form of a zone (a zonal boundary); also, to surround with a zone: to encircleZONED: a region or area set off as distinct from surrounding or adjoining parts (an earthquake zone, a coastal zone); also, one of the sections of an area or territory created for a particular purpose or activity (a construction zone, lives in a different time zone); also, zonal: of, relating to, affecting, or having the form of a zone (a zonal boundary); also, to surround with a zone: to encircleZONING: a region or area set off as distinct from surrounding or adjoining parts (an earthquake zone, a coastal zone); also, one of the sections of an area or territory created for a particular purpose or activity (a construction zone, lives in a different time zone); also, zonal: of, relating to, affecting, or having the form of a zone (a zonal boundary); also, to surround with a zone: to encircle
Position general, of an object, person, etc.
ALIGN: to bring into line or alignmentALIGNING: to bring into line or alignmentARRANGING: to put into a proper order or into a correct or suitable sequence, relationship, or adjustmentCAME: to enter or assume a condition, position, or relation (The artillery came into action.); to extend, to reach (Her dress came to her ankles.)CHANGE: to give a different position, course, or direction to (changed his stance)CHANGED: to give a different position, course, or direction to (changed his stance)CHANGING: to give a different position, course, or direction to (changed his stance)CLAP: to place, put, or set especially energetically (clap him into jail)COLLOCATE: to set or arrange in a place or position; especially: to set side by sideCOME: to enter or assume a condition, position, or relation (The artillery came into action.); to extend, to reach (Her dress came to her ankles.)COMING: to enter or assume a condition, position, or relation (The artillery came into action.); to extend, to reach (Her dress came to her ankles.)EVEN: being in the same plane or line —usually used with with (houses even with each other)FACING: located directly across from something: opposite (an illustration on the facing page); having the front oriented toward a specified direction or location —usually used in combinationGOING: present participle of to go, to have a usual or proper place or position: to belong (These books go on the top shelf.)GONE: past participle of to go, to have a usual or proper place or position: to belong (These books go on the top shelf.)HANG: to keep persistent contact (dogs hung to the trail); to maintain or continue holding a position (hang behind)HANGING: to keep persistent contact (dogs hung to the trail); to maintain or continue holding a position (hang behind)HUNG: to keep persistent contact (dogs hung to the trail); to maintain or continue holding a position (hang behind)LAID: to put or set down (lay your books on the table); to set in order or position (lay a table for dinner, lay brick); to prepare or position for action or operation (lay a fire in the fireplace)LAIN: to occupy a certain relative place or position (hills lie behind us); to have a place in relation to something else (the real reason lies deeper)LAYING: to put or set down (lay your books on the table); to set in order or position (lay a table for dinner, lay brick); to prepare or position for action or operation (lay a fire in the fireplace)LAZY: placed on its side (the lazy E livestock brand)LOCAL: characterized by or relating to position in space: having a definite spatial form or location; also, of, relating to, or characteristic of a particular place: not general or widespread; of, relating to, or applicable to part of a whole; also, primarily serving the needs of a particular limited district (local education programs)LOCATE: to set or establish in a particular spot: to station (located the clock in the exact center of the mantel)LONE: situated by itself: isolatedLYING: to occupy a certain relative place or position (hills lie behind us); to have a place in relation to something else (the real reason lies deeper)MARK: something (such as a line, notch, or fixed object) designed to record positionMEAN: occupying a middle positionMEDIA: plural of medium: something in a middle positionMEDIATE: (adj.) occupying a middle positionMEDIUM: (adj.): intermediate in quantity, quality, position, size, or degree; something in a middle positionMIDDLE: equally distant from the extremes: medial, central; also, a middle part, point, or position; the position of being among or in the midst of somethingMIDLINE: a median line, especially: the median line or median plane of the body or some part of the bodyMIDPOINT: a point at or near the center or middle
MOVE: to change the place or position of (moved the chair to a different part of the room); also, to dislodge or displace from a fixed position: to budge (The knife had sunk deeply into the wood and couldn't be moved.); to cause to go or pass from one place to another with a continuous motion (move the flag slowly up and down); to cause to change position or posture (moved his lips but not a sound was heard)
MOVED: to change the place or position of (moved the chair to a different part of the room); also, to dislodge or displace from a fixed position: to budge (The knife had sunk deeply into the wood and couldn't be moved.); to cause to go or pass from one place to another with a continuous motion (move the flag slowly up and down); to cause to change position or posture (moved his lips but not a sound was heard)NAVEL: the central point: the middle (the ancients held [Delphi] to be the navel of the world)NUCLEI: plural of nucleus, a central point, group, or mass about which gathering, concentration, or accretion takes placeONTO: to a position on (onto the roof)OPPONENT: situated in front
OVER: —used as a function word to indicate position on or motion to the other side or beyond (lives over the way, fell over the edge, Look over there!); also, so as to bring the underside up (turned his cards over); also, from one person or side to another (hand it over; He's gone over to the opposition.)PINPOINT: located, fixed, or directed with extreme precision (pinpoint targets); also, to locate or aim with great precision or accuracy (pinpoint a source)PINPOINTING: located, fixed, or directed with extreme precision (pinpoint targets); also, to locate or aim with great precision or accuracy (pinpoint a source)PLACE: a proper or designated niche or setting; also, to put in or as if in a particular place or position: to set; to direct to a desired spot; to distribute in an orderly manner: to arrangePOINT: a narrowly localized place having a precisely indicated position (walked to a point 50 yards north of the building)PULL: to remove from a place or situation (pull the engine for repair)PULLED: to remove from a place or situation (pull the engine for repair)RANGING: to set in a row or in the proper order; to place among others in a position or situation; to take a positionRIGHT: located to the right of an observer facing the object specified or directed as the right arm would point when raised out to the side; located nearer to the right hand than to the left; the location or direction of the right side (woods on his right); the part on the right side; on or to the right (looked left and right); also, in the exact location or position: precisely (right at his fingertips)RUNNING: to cause to move or flow in a specified way or into a specified position (run cards into a file); also, to cause to pass: to lead (run wires up from the basement)TAIL: a location immediately or not far behind (had a posse on his tail); also, the back or lower part of somethingTAKE: to move onto or into: move into position on (the home team took the field, take the witness stand); to proceed to occupy (take a seat in the rear); to lead, carry, or cause to go along to another place (this bus will take you into town) (took an umbrella with her)TAKEN: to move onto or into: move into position on (the home team took the field, take the witness stand); to proceed to occupy (take a seat in the rear); to lead, carry, or cause to go along to another place (this bus will take you into town) (took an umbrella with her)THWART: situated or placed across something else: transverse; athwart: across especially in an oblique direction; also, to pass through or across TOOK: to move onto or into: move into position on (the home team took the field, take the witness stand); to proceed to occupy (take a seat in the rear); to lead, carry, or cause to go along to another place (this bus will take you into town) (took an umbrella with her)TOPOLOGY: configuration (topology of a molecule, topology of a magnetic field)TWEEN: between: in the time, space, or interval that separates; in intermediate relation toUPON: onVANTAGE: a position giving a strategic advantage, commanding perspective, or comprehensive viewWENT: past tense of to go, to have a usual or proper place or position: to belong (These books go on the top shelf.)
Proximity relative distance; near and far
AFAR: from, to, or at a great distance; also, a great distanceALOOF: removed or distant either physically or emotionally; at a distanceALOOFLY: removed or distant either physically or emotionally; at a distanceAPART: at a little distance; away from one another in space [or time] (e.g., a mile apart)AVAUNT: adverb: away, henceAWAY: from this or that place (go away); by a long distance or interval: absent from a place: gone (away for the weekend); distant in space or time (a lake 10 miles away; the season is two months away)BOTTOM: the remotest or inmost point (sail to the bottom of the bay)CONVENIENT: being near at hand: closeDEPTH: a part that is far from the outside or surface (the depths of the woods)DIVIDED: separated by distanceHAIL: hearing distance: stayed within hailHANDILY: conveniently nearbyHANDY: conveniently nearHARD: close in time or space (the house stands hard by the river)HENCE: from this place: awayNIGH: near in place, time, or relationship; close, near; also, to draw or come near to: to approach; to draw near
OVER: across a barrier or intervening space (over the fence); on the other side of an intervening space (the next town over)RUNNING: to lie or extend in relation to something (The road runs close to the shore.) (There was a scratch running down the side of the car.)TIGHT: having elements close together (a tight formation)TIGHTEN: re: having elements close together (a tight formation): to make tight or tighter; to become tight or tighterTIGHTENING: re: having elements close together (a tight formation): to make tight or tighter; to become tight or tighterTIGHTLY: having elements close together (a tight formation)TOUCH: the act or fact of touching; also, to come close: to verge; to meet without overlapping or penetrating: adjoin; to get to: to reach (The speedometer needle touched 80.)TOUCHED: the act or fact of touching; also, to come close: to verge; to meet without overlapping or penetrating: adjoin; to get to: to reach (The speedometer needle touched 80.)VICINITY: the quality or state of being near: proximityWIDE: so as to leave much space or distance between (placed wide apart); so as to pass at or clear by a considerable distance (ran wide around the left end)WING: a side or outlying region or districtWITHDRAW: to move back or away: to retireWITHIN: in or into the range of (within reach, within sight)YOND: (adv) archaic: yonder; also, (adj) dialect: yonder
Revealed, Uncovered, Visible
BARING: to make or lay (something) bare; to uncoverEVINCE: to display clearly: to revealEVINCED: to display clearly: to revealEVINCING: to display clearly: to revealFADE: to change gradually in loudness, strength, or visibilityFADED: to change gradually in loudness, strength, or visibilityFADING: to change gradually in loudness, strength, or visibilityFIND: an act or instance of finding; also, something found: also, to come upon often accidentally: encounter (found a $10 bill on the ground); FINDING: the act of one that finds; also, an act or instance of finding; also, something found: also, to come upon often accidentally: encounter (found a $10 bill on the ground); FOUND: an act or instance of finding; also, something found: also, to come upon often accidentally: encounter (found a $10 bill on the ground); GAVE: to present to view or observation (gave the signal to start); to afford a view or passage: open (the window gives onto the terrace)GIVE: to present to view or observation (gave the signal to start); to afford a view or passage: open (the window gives onto the terrace)GIVEN: to present to view or observation (gave the signal to start); to afford a view or passage: open (the window gives onto the terrace)GIVING: to present to view or observation (gave the signal to start); to afford a view or passage: open (the window gives onto the terrace)GLEAM: a brief or faint appearance (a gleam of hope); also, to appear briefly or faintly GLEAMED: a brief or faint appearance (a gleam of hope); also, to appear briefly or faintly GLEAMY: of a gleam or gleams: a brief or faint appearance (a gleam of hope)LOOM: the indistinct and exaggerated appearance of something seen on the horizon or through fog or darkness; also, to come into sight in enlarged or distorted and indistinct form often as a result of atmospheric conditions (Storm clouds loomed on the horizon.)LOOMED: the indistinct and exaggerated appearance of something seen on the horizon or through fog or darkness; also, to come into sight in enlarged or distorted and indistinct form often as a result of atmospheric conditions (Storm clouds loomed on the horizon.)LOOMING: the indistinct and exaggerated appearance of something seen on the horizon or through fog or darkness; also, to come into sight in enlarged or distorted and indistinct form often as a result of atmospheric conditions (Storm clouds loomed on the horizon.)OCCUR: to be found or met with: to appear (This bird occurs in New England in the spring.)OPEN: completely free from concealment: exposed to general view or knowledge (erupted in open war); a public or unconcealed state or position; also, presenting no obstacle to passage or view: not enclosed, obstructed, or filled with objects (the open road, open country); also, to disclose or expose to view: to reveal; also, to become disclosed; also, to bring into view or come in sight of by changing positionOPENED: completely free from concealment: exposed to general view or knowledge (erupted in open war); a public or unconcealed state or position; also, presenting no obstacle to passage or view: not enclosed, obstructed, or filled with objects (the open road, open country); also, to disclose or expose to view: to reveal; also, to become disclosed; also, to bring into view or come in sight of by changing positionOPTICAL: visible (an optical wavelength)OUTCROP: to come to the surface: to appearPANORAMA: an unobstructed or complete view of an area in every direction (a panorama of the little bay beyond the rocky shore)PATENT: readily visible or intelligible: obvious (his patent sincerity, a patent falsehood, patently obvious)PATENTLY: readily visible or intelligible: obvious (his patent sincerity, a patent falsehood, patently obvious)PEEP: to begin to emerge from or as if from concealment: to show slightlyPEEPED: to begin to emerge from or as if from concealment: to show slightlyPEEPING: to begin to emerge from or as if from concealment: to show slightlyPLAIN: free of impediments to view: unobstructedPLAINLY: free of impediments to view: unobstructedPOPPED: to be or become striking or prominent (colors that pop, flavors that pop)POPPING: to be or become striking or prominent (colors that pop, flavors that pop)PUBLIC: exposed to general view: openRAWLY: raw: lacking covering: nakedUNCLOAK: reveal, unmask (uncloak an impostor) UNHIDDEN: not hiddenUNVEIL: to make public: divulge, reveal (a good time to unveil their plans)UNVEILING: to make public: divulge, reveal (a good time to unveil their plans)
Slopes and Slants includes level, unlevel
ATILT: in a tilted positionBANK: a steep slope (as of a hill)BEVEL: oblique, beveled: a bevel edge; also, to cut or shape to a bevel; also, to incline or slantBEVELING: or bevelling; oblique, beveled: a bevel edge; also, to cut or shape to a bevel; also, to incline or slantBEVELLING: variant of beveling, oblique, beveled: a bevel edge; also, to cut or shape to a bevel; also, to incline or slantBOLD: sheer, steep (bold cliffs)BOLDLY: sheer, steep (bold cliffs)BOWED: to cause to incline (wind bowing the treetops)BOWING: to cause to incline (wind bowing the treetops)CANT: an oblique or slanting surface (the cant of a riverbank); an external angle (as of a building); an inclination, slope (the cant of a gun barrel); also, to pitch to one side: to lean (the deck of the ship was canting); to slope (the roof canted gently); also, to set at an angle: to tilt (cant a cask); inclined: having a leaning or slope, or making an angle with a line or plane (a cant buttress)CANTING*: an oblique or slanting surface (the cant of a riverbank); an external angle (as of a building); an inclination, slope (the cant of a gun barrel); also, to pitch to one side: to lean (the deck of the ship was canting); to slope (the roof canted gently); also, to set at an angle: to tilt (cant a cask); inclined: having a leaning or slope, or making an angle with a line or plane (a cant buttress)CLIMB: to slope upward (a climbing path)COCK: to turn, tip, or tilt usually to one side (cock one's head); a tilt or slant (cock of the head, the jaunty cock of his hat)COCKED: to turn, tip, or tilt usually to one side (cock one's head); a tilt or slant (cock of the head, the jaunty cock of his hat)COCKING: to turn, tip, or tilt usually to one side (cock one's head); a tilt or slant (cock of the head, the jaunty cock of his hat)DECLINE: a downward slope (built on a slight decline); also, to slope downward: to descendDECLINED: a downward slope (built on a slight decline); also, to slope downward: to descendDIPPED: to incline downward from the plane of the horizonDIPPING: to incline downward from the plane of the horizonEASY: not steep or abrupt (easy slopes)EVEN: having a horizontal surface: flat (even ground); level; being in the same plane or line; also, to make even; to become evenEVENED: having a horizontal surface: flat (even ground); level; being in the same plane or line; also, to make even; to become evenEVENING: having a horizontal surface: flat (even ground); level; being in the same plane or line; also, to make even; to become evenFLAT: lying at full length or spread out upon the ground: prostrate; having a continuous horizontal surfaceFLATLY: lying at full length or spread out upon the ground: prostrate; having a continuous horizontal surfaceFLATTEN: to make flatHANG: declivity, slope; also, to lean, incline, or jut over or downward (a rocky cliff that hangs overhead)HANGING: declivity, slope; also, to lean, incline, or jut over or downward (a rocky cliff that hangs overhead)HUNG: declivity, slope; also, to lean, incline, or jut over or downward (a rocky cliff that hangs overhead)INCLINE: an inclined plane: a grade, a slope; also, to deviate from the vertical or horizontal; to give a bend or slant toINCLINED: an inclined plane: a grade, a slope; also, to deviate from the vertical or horizontal; to give a bend or slant toINCLINING: inclination (noun): a deviation from the true vertical or horizontal: a slant; a tilting of something; also: the degree of such deviation; also, an inclined surface: a slope; also, an inclined plane: a grade, a slope; also, to deviate from the vertical or horizontal; to give a bend or slant toLAIN: to be or to stay at rest in a horizontal position: be prostrate: to rest, recline; to assume a horizontal position —often used with down (to lie down); of an inanimate thing: to be or remain in a flat or horizontal position upon a broad support (books lying on the table)LEAN: the act or an instance of leaning: inclination; to make lean (lean that lumber up against this fence); to incline, deviate, or bend from a vertical position; to cause to lean: to incline (The boy leaned his head on his mother's shoulder.); to cast one's weight to one side for support (lean on me) LEANED: the act or an instance of leaning: inclination; to make lean (lean that lumber up against this fence); to incline, deviate, or bend from a vertical position; to cause to lean: to incline (The boy leaned his head on his mother's shoulder.); to cast one's weight to one side for support (lean on me) LEANING: the act or an instance of leaning: inclination; to make lean (lean that lumber up against this fence); to incline, deviate, or bend from a vertical position; to cause to lean: to incline (The boy leaned his head on his mother's shoulder.); to cast one's weight to one side for support (lean on me) LEANT: chiefly British past tense of lean: the act or an instance of leaning: inclination; to make lean (lean that lumber up against this fence); to incline, deviate, or bend from a vertical position; to cause to lean: to incline (The boy leaned his head on his mother's shoulder.); to cast one's weight to one side for support (lean on me)LEVEL: horizontal condition, especially: equilibrium of a fluid marked by a horizontal surface of even altitude (water seeks its own level); also, an approximately horizontal line or surface taken as an index of altitude (at eye level); also, to make (a line or surface) horizontal: make flat or level (level a field, level off a house lot); to attain or come to a level (the plane leveled off at 10,000 feet)LEVELED: horizontal condition, especially: equilibrium of a fluid marked by a horizontal surface of even altitude (water seeks its own level); also, an approximately horizontal line or surface taken as an index of altitude (at eye level); also, to make (a line or surface) horizontal: make flat or level (level a field, level off a house lot); to attain or come to a level (the plane leveled off at 10,000 feet)
LEVELER: one that levels, to make (a line or surface) horizontal: make flat or level (level a field, level off a house lot); to attain or come to a level (the plane leveled off at 10,000 feet)LEVELING: horizontal condition, especially: equilibrium of a fluid marked by a horizontal surface of even altitude (water seeks its own level); also, an approximately horizontal line or surface taken as an index of altitude (at eye level); also, to make (a line or surface) horizontal: make flat or level (level a field, level off a house lot); to attain or come to a level (the plane leveled off at 10,000 feet)LYING: to be or to stay at rest in a horizontal position: be prostrate: to rest, recline; to assume a horizontal position —often used with down (to lie down); of an inanimate thing: to be or remain in a flat or horizontal position upon a broad support (books lying on the table)PITCH: a steep place: a declivity; a slope; also: the degree of slope: rake; also, to cause to be set at a particular angle: to slope; also, to incline downward: to slopePITCHED: a steep place: a declivity; a slope; also: the degree of slope: rake; also, to cause to be set at a particular angle: to slope; also, to incline downward: to slopePITCHING: a steep place: a declivity; a slope; also: the degree of slope: rake; also, to cause to be set at a particular angle: to slope; also, to incline downward: to slope
OVER: from a vertical to a prone or inclined position (knocked the lamp over)RAKING: to incline from the perpendicularRAMP: a sloping way or planeRIGHT: to bring or restore to an upright position (right a capsized boat); to become uprightRIGHTING: to bring or restore to an upright position (right a capsized boat); to become uprightTILT: a sloping surface; also, the act of tilting : the state or position of being tilted; also, to cause to have an inclination; to move or shift so as to lean or incline: to slantTILTED: a sloping surface; also, the act of tilting : the state or position of being tilted; also, to cause to have an inclination; to move or shift so as to lean or incline: to slantTILTING: a sloping surface; also, the act of tilting : the state or position of being tilted; also, to cause to have an inclination; to move or shift so as to lean or incline: to slantTIPPED: to cant, to tilt; to lean, to slantTIPPING: to cant, to tilt; to lean, to slantTIPPY: liable to tipTOBOGGAN: a downward course or a sharp declineUNEQUAL: not level (unequal ground)UNEVEN: not even: not level or smooth: rugged, ragged (large uneven teethuneven handwriting, uneven ground)UNEVENLY: not even: not level or smooth: rugged, ragged (large uneven teethuneven handwriting, uneven ground)UNLEVEL: not level uneven (tennis lawns grown lank and unlevel); also, to destroy the level character of: to make uneven (moles unleveled the lawn)UNTRULY: in an untrue manner: not level or exact (untrue doors)UPTILT: to tilt upward
Storage Places and Spaces not furniture, not containers
CACHE: a hiding place especially for concealing and preserving provisions or implements; also, a secure place of storage; also, something hidden or stored in a cache; also, to place (something) in a cache: to place or store (something) in a hidden or secure place for safety or concealmentCACHED: a hiding place especially for concealing and preserving provisions or implements; also, a secure place of storage; also, something hidden or stored in a cache; also, to place (something) in a cache: to place or store (something) in a hidden or secure place for safety or concealmentCACHING: a hiding place especially for concealing and preserving provisions or implements; also, a secure place of storage; also, something hidden or stored in a cache; also, to place (something) in a cache: to place or store (something) in a hidden or secure place for safety or concealmentCUBBY: a small, snug place (as for hiding or storage): a cubbyholeDUMP: a quantity of reserve materials accumulated at one place; also, a place where such materials are stored (ammunition dump)HIVE: to store up in or as if in a hiveHIVED: to store up in or as if in a hiveHIVING: to store up in or as if in a hiveMOTHBALL: mothballs plural: a condition of protective storage (put the ships in mothballs after the war) ; also, (verb) to deactivate (something, such as a ship) and prevent deterioration chiefly by dehumidification; also, to withdraw from use or service and keep in reserve: to put asideROLL: a flexible case (as of leather) in which articles may be rolled and fastened by straps or clasps (jewelry roll)TIDY: a usually compartmentalized receptacle for various small objectsTILL: a box, drawer, or tray in a receptacle (such as a cabinet or chest) used especially for valuables
Surrounding, Surroundings
ABOUT: on all sides: aroundAMBIENT: an encompassing atmosphere: environment; existing or present on all sides: encompassing (as of light, sound, etc.)AMBIT: circuit, compass; the bounds or limits of a place or district AMID: in or into the middle of: surrounded by: among (e.g., amid the crowd)AMONG: in or through the midst of: surrounded byAROUND: on all or various sides: in every or any direction (e.g., papers lying around; there was nothing for miles around, a yard with a fence around it); in close from all sides so as to surround (e.g., people crowded around); so as to encircle or enclose (e.g., seated around the table); in all directions outward from (e.g., look around you)CLIP: to encompass, to include as a part of a whole or groupCLIPPED: to encompass, to include as a part of a whole or groupEMBED: to surround closely (a sweet pulp embeds the plum seed)EMBEDDED: to surround closely (a sweet pulp embeds the plum seed)OPEN: an open and unobstructed space; having no enclosing or confining barrier: accessible on all or nearly all sides (the open range, open air, open water); being in a position or adjustment to permit passage: not shut or locked (an open door); having a barrier (such as a door) so adjusted as to allow passage (the house was open); also, presenting no obstacle to passage or view: not enclosed, obstructed, or filled with objects (the open road, open country)OPENED: an open and unobstructed space; having no enclosing or confining barrier: accessible on all or nearly all sides (the open range, open air, open water); being in a position or adjustment to permit passage: not shut or locked (an open door); having a barrier (such as a door) so adjusted as to allow passage (the house was open); also, presenting no obstacle to passage or view: not enclosed, obstructed, or filled with objects (the open road, open country)PANORAMA: an unobstructed or complete view of an area in every direction (a panorama of the little bay beyond the rocky shore)PLACE: an indefinite region or expanse (all over the place)PLACE: physical surroundings: atmosphere; physical environment: spaceRING: an encircling arrangement (a ring of suburbs around the city); also, to place or form a ring around: to encircle (police ringed the building)RINGING: an encircling arrangement (a ring of suburbs around the city); also, to place or form a ring around: to encircle (police ringed the building)ROLL: to lie extended: to stretch (fields rolling to the west)TRACT: an indefinite stretch of landTURF: territory: an indeterminate geographic areaVIEW: a scene, prospect (the lovely view from the balcony)WIDE: having great extent: vast (a wide area); extending over a vast area : extensive (a wide reputation); extending throughout a specified area or scope —usually used in combination (nationwide, industry-wide); over a great distance or extent: widely (searched far and wide); over a specified distance, area, or extent —usually used in combination (expanded the business country-wide)
Ups and Downs words about high and low
ABOVE: in the sky: overhead; in or to a higher place; upstairsACME: the highest point or stageALOFT: (adj.) at or to a great height; preposition: on top of: aboveAPEX: the uppermost point: vertex; the highest or culminating point ATOP: on, to, or at the top; on top ofBELOW: in or to a lower placeBOTTOM: the underside of something; also, the lowest part or place (the bottom of the page, bottom of the stairs); also, a surface designed to support something resting on it; also, to furnish (something, such as a chair) with a bottom; to provide a foundation for; also, frequenting the lowest part or place: frequenting the bottom (bottom fish); also, to reach the bottom or to bring to the bottom (bottomed the submarine on the ocean floor)BOTTOMED: the underside of something; also, the lowest part or place (the bottom of the page, bottom of the stairs); also, a surface designed to support something resting on it; also, to furnish (something, such as a chair) with a bottom; to provide a foundation for; also, frequenting the lowest part or place: frequenting the bottom (bottom fish); also, to reach the bottom or to bring to the bottom (bottomed the submarine on the ocean floor)CHOPPY: interrupted by ups and downs (choppy terrain, a choppy career)CROUCH: to stand at a low height (Cottages crouched along the river.)DEEP: extending far from some surface or area: extending far downward; to a great depth: deeplyDEEPEN: to make deep or deeperDEEPENED: to make deep or deeperDEEPENING: to make deep or deeperDEEPLY: extending far from some surface or area: extending far downward; to a great depth: deeplyDEPTH: the quality of being deep (the depth of the water)DROP: the distance from a higher to a lower level or through which something drops (a twenty-foot drop from the top of the fence); also, to descend from one line or level to another (the land drops to sea level)DROPPING: the distance from a higher to a lower level or through which something drops (a twenty-foot drop from the top of the fence); also, to descend from one line or level to another (the land drops to sea level)EXALT: to raise high: to elevateEXALTED: to raise high: to elevateEXALTEDLY: to raise high: to elevateFALL: to move or extend in a downward direction (the land falls away to the east)FALLEN: to move or extend in a downward direction (the land falls away to the east)FALLING: to move or extend in a downward direction (the land falls away to the east)FALLS: to move or extend in a downward direction (the land falls away to the east)FELL: to move or extend in a downward direction (the land falls away to the east)HIGH: situated or passing above the normal level, surface, base of measurement, or elevation (the high desert, houses built on high ground); also, at or to a high place, altitude, level, or degree (climbed higher)LEVEL: to lay level with or as if with the ground: to razeLEVELED: to lay level with or as if with the ground: to raze
LEVELER: one that levels, to lay level with or as if with the ground: to razeLEVELING: to lay level with or as if with the ground: to razeLIFT: a slight rise or elevationLIFTING: a slight rise or elevationMIDAIR: a point or region in the air not immediately adjacent to the groundNADIR: the lowest pointNEATH: dialect: beneathNOON: the highest point
OVER: —used as a function word to indicate motion or situation in a position higher than or above another (towered over his mother, flew over the lake, rode over the old Roman road); —used as a function word to indicate position upon or movement down upon (a funny look came over his face, laid a blanket over the child, hit him over the head); also, upper, higher; above, overhead (The plane was directly over.)ROOF: the highest point: summit (the roof of heaven); an upper limit: ceiling (the roof of the cave)TIPTOP: M-W hyphenates tip-top, the highest pointUPEND: to set or stand on end; to rise on an end; also: overturn (upended the bucket to use as a stool)UPENDED: to set or stand on end; to rise on an end; also: overturn (upended the bucket to use as a stool)UPTURN: to turn up or over (upturned a trash can); to direct upward; to turn upwardVALLEY: a low point or condition; a hollow, a depression
Spelling Bee words related to
PLACES AND SPACES
ABOUTABOVEABROADABUTACMEADHIBIT*ADJACENCYADMITADMITTEDADMITTINGAFARAJARALIGNALIGNINGALOFTALONGALOOFALOOFLYAMBIANCEAMBIENCEAMBIENTAMBITAMIDAMONGANGLEANGLEDANYPLACEAPARTAPEXARCADIAARCADIANAROUNDARRANGINGATHWARTATILTATOPAVAUNTAWAYAWRYAXIALAXIALLYBACKBACKROOMBACKWARDBACKYARDBAGGEDBAGGINGBAILBAILINGBANKBANNEDBANNINGBARINGBARRINGBELLIEDBELLYBELOWBELOWBEVELBEVELINGBEVELLINGBLANKBLANKETBLINDBLINDINGBLOATBLOCKBLOCKEDBLOCKSBOLDBOLDLYBOTTLEBOTTOMBOTTOMEDBOUNDBOUNDEDBOWEDBOWINGBOXINGBRIMBURYBUTTBUTTEDBUTTINGBUTTONBUTTONEDBUTTONINGCACHECACHEDCACHINGCAGECAGEDCAGINGCAKECAKEDCAKINGCAMECAMECANTCANTING*CAPPEDCAPPINGCAPTIVITYCAPTORCHANGECHANGEDCHANGINGCHARGINGCHOCKCHOKECHOKINGCHOPPYCIRCUITCLAPCLEANCLEANEDCLEANINGCLEFTCLIMBCLIPCLIPPEDCLOAKCLOAKEDCLOGCLOGGINGCOCKCOCKEDCOCKINGCOLLOCATECOMECOMINGCONCAVECONCEALCONFINECONFINED
CONFININGCONTACTCONTAINCONVENIENTCOPECOPEDCOPPEDCOPPINGCOUNTRYCRACKCRAMCRAMPCRANNYCROUCHCUBBYCURTAINDEADDECLINEDECLINEDDEEPDEEPENDEEPENEDDEEPENINGDEEPLYDEFINEDEFINEDDEFININGDENTDENTEDDEPLETEDEPLETEDDEPTHDIAGONALDIPPEDDIPPINGDIVIDEDDIVOTDOGGODRAINDRAININGDROPDROPPINGDUMP
EASYEDENIC*EDGEEDGEDEDGINGEDIFICEEJECTEJECTABLEEJECTEDEJECTIONEMANANT*EMANATEEMBEDEMBEDDEDEMITEMITTEDEMITTINGEMPTIEDEMPTYENCAGEENCAGEDENCAGINGENDEMICENLACEENLACEDENLACINGEVENEVENEDEVENINGEVICTEVICTEDEVICTIONEVINCEEVINCEDEVINCINGEVOLVEEVOLVEDEVOLVINGEXALTEXALTEDEXALTEDLYEXCAVATEEXCAVATEDEXPELEYEHOLEEYELETFACINGFADEFADEDFADINGFALLFALLENFALLINGFALLSFEEDFEEDINGFELL
FENCEFENCEDFENCINGFILLFILLABLEFILLEDFILLINGFINDFINDINGFITTEDFITTINGFLATFLATLYFLATTENFLOORFLOWNFOUNDFULLGAGGEDGAGGINGGAPPY*GAVEGIVEGIVENGIVINGGLEAMGLEAMEDGLEAMYGLOBALGOINGGONEGOUGEGOUGEDGOUGINGGUARDGUARDINGHAILHANDHANDILYHANDYHANGHANGINGHARDHEAVENHEAVENLYHEDGEHEDGEDHEDGINGHELDHELLHELLHOLEHENCEHIDDENHIDEHIDINGHIGHHIVEHIVEDHIVINGHOLDHOLEHOLEDHOLEYHOLINGHOLLOWHOLLOWINGHOOKYHUNGIMPRINTINANEINCLINEINCLINEDINCLININGINCOMINGINDENTINDENTEDINFILLINFILLEDINFILLINGINJECTINJECTEDINJECTIONINLETINPUTINPUTINTOINWARDJAMMINGKNEEHOLELACUNALACUNAL*LAIDLAINLAIRLANDLAPPEDLAPPINGLAYINGLAZY
LEACHLEACHEDLEADLEANLEANEDLEANINGLEANTLEFTLEVELLEVELED
LEVELERLEVELINGLIEULIFTLIFTINGLIMBOLIMINALLIMITLINELINEDLININGLIVELIVEDLIVINGLOCALLOCALELOCALLYLOCATELOCATORLOCILODGELODGEDLONELOOKLOOKEDLOOMLOOMEDLOOMINGLOOPHOLELURKLURKINGLYINGMADEMAKEMAKINGMANTLEMANUMITMARGINMARKMAZEMEANMECCAMEDIAMEDIATEMEDIUMMEWEDMEWINGMIDAIRMIDDLEMIDLINEMIDPOINTMILIEUMOTHBALL
MOVE
MOVEDNADIRNAILNAILINGNATALNATIVENAVELNEATHNECKNETTEDNETTINGNEXTNIGHNIRVANANONLOCALNOOKNOONNORTHNUCLEIOCCLUDEOCCLUDEDOCCULTOCCURONTOOOZEOOZEDOOZINGOPENOPENABLEOPENEDOPPONENTOPTICALOUTBOUNDOUTCROPOUTDOOROUTPOUR
OVERPACKPACKEDPALEPALLPALLEDPALLINGPALMPALMEDPANOPLYPANORAMAPARTPATCHPATENTPATENTLYPATHPAWNPEEPPEEPEDPEEPHOLEPEEPINGPENNEDPENNINGPENTPHANTOMPINHOLEPINPOINTPINPOINTINGPITCHPITCHEDPITCHINGPITTEDPITTINGPLACEPLAINPLAINLYPLANTPLENAPLENUMPLOTPLOTTINGPLUGPLUMPPOCKETPOINTPOINTINGPOKEPOLARPOLEPOPPEDPOPPEDPOPPINGPOUNDPOURPOURINGPRICKPRIMINGPUBLICPULLPULLEDRADIIRAKINGRAMPRANGINGRAWLYRIDINGRIFTRIFTINGRIGHTRIGHTINGRIMMINGRINGRINGINGROBBINGROLLROOFROOMROOMYROUTRUNNINGRURALRURALLYTAILTAKETAKENTAPPEDTAPPINGTARPTEEMTEEMEDTEEMINGTEMPLETENDTENDEDTHATAWAYTHENCETHROUGHTHROUGHOUTTHWARTTIDYTIGHTTIGHTENTIGHTENINGTIGHTLYTILLTILTTILTEDTILTINGTIPPEDTIPPINGTIPPYTIPTOPTOBOGGANTOOKTOPOLOGYTOPPEDTOPPINGTOUCHTOUCHEDTOWNTRACTTRAINTRAPTUCKTUCKEDTURFTURNTWEENUNBAGUNBAGGINGUNBANUNBANNEDUNBANNINGUNBARUNBINDUNBINDINGUNBOUNDUNBOUNDEDUNBOXUNBOXINGUNBUTTONUNBUTTONEDUNBUTTONINGUNCAGINGUNCAPUNCAPUNCLENCHUNCLENCHEDUNCLOAKUNCLOGUNCLOGGINGUNDETECTEDUNEQUALUNEVENUNEVENLY
UNFENCEDUNFOUND*UNHIDDENUNJAMUNJAMMINGUNLATCHUNLEVELUNLINEDUNLOCKUNNOTEDUNOPENUNOPENEDUNPENUNPENNEDUNPENNINGUNROOF*UNTOUNTRULYUNVEILUNVEILINGUNZIPUNZIPPEDUPENDUPENDEDUPONUPTILTUPTURNVACANCYVACANTVALLEYVANTAGEVEILVEILEDVEILINGVENUEVICINITYVICINITYVIEWVOIDVOIDEDVOLLEYVOMITWADDEDWADDINGWAITWALLWALLEDWALLINGWARDWARDINGWEDGEWEDGEDWEDGINGWELLWENTWHENCEWIDEWIDEWINDWINDOWWINDWARDWINGWINKWINKINGWITHDRAWWITHINWOMBWOODWORKWORKWORKINGWRAPWRAPPING YONDZIPPEDZONALZONEZONEDZONING