LexiConnexxions
  • Home
    • Contact
  • The Lexicon
    • Bee Words with Histories
    • The Midden: Discontinued Bee Words
    • IN-OUT Words
    • OUT-IN Words
    • IN-OUT-IN Words
    • OUT-IN-OUT Words
    • FLIP-FLOP Words
    • Pangrams with Checkered Histories
    • Pangram Ratios to Word Counts
    • 2025 Annual Summary
    • 2024 Annual Summary
    • 2023 Annual Summary
    • 2026 Jul Summary
    • 2026 Jun Summary
    • 2026 May Summary
    • 2026 Apr Summary
    • 2026 Mar Summary
    • 2026 Feb Summary
    • 2026 Jan Summary
    • 2025 Dec Summary
    • 2025 Nov Summary
    • 2025 Oct Summary
    • 2025 Sep Summary
    • 2025 Aug Summary
    • 2025 Jul Summary
    • 2025 Jun Summary
    • 2025 May Summary
    • 2025 Apr Summary
    • 2025 Mar Summary
    • 2025 Feb Summary
    • 2025 Jan Summary
    • 2024 Dec Summary
    • 2024 Nov Summary
    • 2024 Oct Summary
    • 2024 Sep Summary
    • 2024 Aug Summary
    • 2024 Jul Summary
    • 2024 Jun Summary
    • 2024 May Summary
    • 2024 Apr Summary
    • 2024 Mar Summary
    • 2024 Feb Summary
    • 2024 Jan Summary
    • 2023 Dec Summary
    • 2023 Nov Summary
    • 2023 Oct Summary
    • 2023 Sep Summary
    • 2023 Aug Summary
    • 2023 Jul Summary
  • Reports & Records
    • Bees of Special Interest
    • 2500th Spelling Bee
    • Goofs and Gaffes
    • All Letters in Bee History
    • Bees with Only One Vowel
    • Bees with J Q S X Z
    • Bees with Letter S
    • Bees with I+N+G and/or E+D
    • Center Letters in Bee History
    • Starting Letters Center Letter Only
    • Starting Letters No Center Letter
    • Starting Letters Fewest
    • Starting Letters No Vowels
  • LexiTopics
    • About the LexiTopics Project
    • The LexiTopics Taxonomy
    • Agriculture & Farm Life
    • Animals
    • Astronomy
    • Attire Fashion & Style
    • Aviation & Aircraft
    • Belief Systems
    • Biology
    • Botanicals
    • Buildings Architecture & Construction
    • Business & Commerce
    • Chemistry
    • Colors
    • Conditions & Characteristics
    • Dance
    • Dramatic Arts
    • Economics & Finance
    • Energy Light Sound Heat
    • Engineering
    • Entertainment Hospitality & Service
    • Environment Habitat & Nature
    • Events & Incidents
    • Existence & Change
    • Food & Drink
    • Furnishings & Fitments
    • Games Toys & Play
    • Geology & Geography
    • Government Civics & Politics
    • History & Olden Times
    • Human Anatomy
    • Human Health & Medicine
    • Information & Communication Technologies
    • Intoxicants
    • Knowledge & Information
    • Law Crime & Courts
    • Learning Education & Research
    • Machines Tools & Devices
    • Manufacturing Products & Packaging
    • Mathematics
    • Matter & Materials
    • Measures & Measurements
    • Motions: Actions & Operations
    • Motions: Coming & Going
    • Motions: Movements
    • Music
    • Myth & Magic
    • Nautical & Maritime
    • Numbers
    • Objects & Collections
    • Occupations
    • People: Character & Appearance
    • People: Efforts & Endeavors
    • People: Emotion & Affect
    • People: Engagement & Interaction
    • People: Individuals & Groups
    • People: Movements & Motions
    • People: Thought & Comprehension
    • Physics
    • Places & Spaces
    • Possession Use & Disposal
    • Quantity Extent Size & Degree
    • Shapes & Textures
    • Speech & Verbal Expression
    • Sports & Recreation
    • Textiles Fibers & Needlecrafts
    • Time
    • Transportation & Travel
    • Visual Arts
    • Weapons & Warfare
    • Weather & Climate
    • Words & Language
    • Writing & Publishing
  • WordPlay
    • Etymologies Brand Names
    • Etymologies Eponyms
    • Etymologies Literary & Film References
    • Etymologies Portmanteaux & Blend-Words
    • Etymologies Toponyms
    • Rogues Offensive
    • Spelling Counts Abandoned Accents
    • Spelling Counts Abbreviations etc.
    • Spelling Counts Clipped Words & Phrases
    • Spelling Counts Palindromes
    • Spelling Counts Reductions Contractions
    • Spelling Counts WORDZ
    • Topics Alphabet Soup
    • Topics Chemical Elements
    • Topics ILLIONs TEENs & NTHs
    • Topics OLOGIES
    • Topics Personal Names
    • Topics State Birds
    • Topics Vehicle Makes & Models
    • Solver List ABLE IBLE
    • Solver List AUGH EIGH IGH OUGH
    • Solver List CATS AND DOGS
    • Solver List -EE
    • Solver List -FUL-
    • Solver List NYMs
    • Solver List WOMAN MAN GIRL BOY
    • Solver List WOOD WIND WILD
    • Wanderings GIRD
    • Wanderings JECT
    • Wanderings MOTORWAY
  • Gameplay
    • The Puzzle Page
    • Entering Words in the Puzzle
    • Ranks and Scoring
    • The Official Hints Page
    • Pangrams and Bingo
    • Solv-ING Tips
    • Looking Up Bee Words
    • Navigating the Forum
    • Participating in the Forum
    • Beeatrice
  • Resources
    • Spelling Bee Dictionaries
    • Spelling Bee Info from NYT
    • Spelling Bee Editor
    • Spelling Bee Community
    • NYT Games Info from NYT
    • Spelling Bee in the News
    • Spelling Bee Research & Data
    • Spelling Bee Transcripts

LexiTopic: Quantity, Extent, Size, and Degree

If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to QUANTITY, EXTENT, SIZE, AND DEGREE in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Taxonomy for Spelling Bee words related to QUANTITY, EXTENT, SIZE, AND DEGREE
SUBJECT HEADINGS IN THIS LEXITOPIC: Decrease, Reduce quantity, extent, size, or degreeDegree: GreatDegree: ModerateDegree: Slight or NoneDegree: UnspecifiedDimension general bulk and magnitude; not shapeEqual EstimatesExtent: LimitedExtent: MaximumExtent: MinimumExtent: UnlimitedExtent: UnspecifiedImprecise, Inexact, ApproximateIncrease, Augment quantity, extent, size, or degreePrecise, ExactQuantity: General TermsQuantity: Little or Less ThanQuantity: Medium or MiddlingQuantity: Much or More ThanQuantity: Nothing Ranks, Levels, Stages, Steps not numbersSize: Large or Larger ThanSize: Medium or MiddlingSize: Small or Smaller Than Unequal
NOTES ABOUT THE TAXONOMY FOR QUANTITY, EXTENT, SIZE, AND DEGREE SCOPE NOTE: This LexiTopic compiles and defines Bee words related (in general) to how we perceive and articulate conditions such as quantity, extent, and size, without reference to specific units, measurements, etc. Words related to height, distance, dimension, units of measurement, etc., are in MEASURES AND MEASUREMENTS. Words related to specific numbers (cardinal, ordinal, fractions, sequences, numbered groups, equal, etc.) are in NUMBERS. Words related to individual persons and groups of people are in PEOPLE: INDIVIDUALS AND GROUPS. Words related to the science of numbers and their operations are in MATHEMATICS. Words related to parts, pieces, collections, individual things, etc., are in OBJECTS AND COLLECTIONS.
Topical arrangement of Spelling Bee words related to QUANTITY, EXTENT, SIZE, AND DEGREE
Decrease, Reduce quantity, extent, size, or degree
ABATE: to decrease in force or intensity; to decrease in amount or valueABATED: to decrease in force or intensity; to decrease in amount or valueABATEMENT: the act or process of reducing or otherwise abating something, to decrease in force or intensity; to decrease in amount or valueABATING: to decrease in force or intensity; to decrease in amount or valueALLAY: to subdue or reduce in intensity or severity: alleviateALLAYED: to subdue or reduce in intensity or severity: alleviateALLAYING: to subdue or reduce in intensity or severity: alleviateALLOY: to temper, to moderateALLOYED: to temper, to moderateALLOYING: to temper, to moderateATTENUATE: to lessen the amount, force, magnitude, or value of: weaken; to reduce the severity, virulence, or vitality of; to make thin or slender: to make thin in consistency: rarefyATTENUATED: to lessen the amount, force, magnitude, or value of: weaken; to reduce the severity, virulence, or vitality of; to make thin or slender: to make thin in consistency: rarefyBATE: to reduce the force or intensity of: restrain; to take away: deductBATED: to reduce the force or intensity of: restrain; to take away: deductCLIP: to curtail; to diminishCLIPPED: to curtail; to diminishCONTRACT: to limit, restrict (contract the scope of their activities); to draw together: to concentrate (He contracted his armies into one force.); to reduce to smaller size by or as if by squeezing or forcing together (contract a muscle); to become less in compass, duration, or length (Muscle contracts in tetanus.); to draw together so as to become diminished in size (Metal contracts on cooling.)CONTRACTOR: something (such as a muscle) that contracts or shortensCONTROL: to reduce the incidence or severity of especially to innocuous levels (e.g., control a disease)CULL: to reduce or control the size of CULLED: to reduce or control the size of CULLING: to reduce or control the size of CUTBACK: something cut back; a reductionDECAY: a decrease in quantity, activity, or force; also, to decrease usually gradually in size, quantity, activity, or forceDECAYED: a decrease in quantity, activity, or force; also, to decrease usually gradually in size, quantity, activity, or forceDECIMATE: to reduce drastically especially in number (cholera decimated the population)DECIMATED: to reduce drastically especially in number (cholera decimated the population)DECLINE: to become less in amount (The price of the stock declined.); also, the process of declining (a period of economic decline; a decline in the local bird population)DECLINED: to become less in amount (The price of the stock declined.); also, the process of declining (a period of economic decline; a decline in the local bird population)DEFLATE: to reduce in size, importance, or effectivenessDEFLATED: to reduce in size, importance, or effectivenessDIPPED: to decline or decrease moderately and usually temporarily (prices dipped)DIPPING: to decline or decrease moderately and usually temporarily (prices dipped)DOCK: to take away a part of: abridgeDOCKED: to take away a part of: abridgeDROP: a decline in quantity or quality (a drop in demand); to become less (production dropped); also, to cause to lessen or decrease: reduce (dropped his speed)DROPPING: a decline in quantity or quality (a drop in demand); to become less (production dropped); also, to cause to lessen or decrease: reduce (dropped his speed)DWINDLE: to become steadily less: to shrink; to make steadily lessDWINDLED: to become steadily less: to shrink; to make steadily less EASE: to moderate or reduce especially in amount or intensity (ease a flow); to become less intense, vigorous, or engaged: to become moderate —usually used with up or off (told her staff to ease up a little; expected the storm to ease off; ease up on fatty foods); to make less difficult (ease credit)EASES: to moderate or reduce especially in amount or intensity (ease a flow); to become less intense, vigorous, or engaged: to become moderate —usually used with up or off (told her staff to ease up a little; expected the storm to ease off; ease up on fatty foods); to make less difficult (ease credit)FAIL: to fade or die away (until our family line fails) (the light is failing as the sun sets)FAILING: to fade or die away (until our family line fails) (the light is failing as the sun sets)FALL: to subside, abate (the wind is falling)FALLEN: to subside, abate (the wind is falling)FALLING: to subside, abate (the wind is falling)FALLOFF: a decline especially in quantity or qualityFALLOFFS: a decline especially in quantity or qualityFALLS: to subside, abate (the wind is falling)FELL: to subside, abate (the wind is falling)FINE: to become smaller in lines or proportionsFINED: to become smaller in lines or proportionsFINING: to become smaller in lines or proportionsFLAGGING: becoming progressively less: dwindling (flagging demand for the product)LIMIT: to curtail or reduce in quantity or extentMINIMIZATION: to reduce or keep to a minimumMINIMIZE: to reduce or keep to a minimumMINIMIZED: to reduce or keep to a minimumMINIMIZING: to reduce or keep to a minimumMODIFY: to make less extreme: to moderateNARROW: to decrease the breadth or extent of: to contract —often used with down; to decrease the scope or sphere of: to limit —often used with down (narrow down the choices); to lessen in width or extent: to contract —often used with downNARROWLY: to decrease the breadth or extent of: to contract —often used with down; to decrease the scope or sphere of: to limit —often used with down (narrow down the choices); to lessen in width or extent: to contract —often used with downNIBBLE: to take away bit by bit (waves nibbling the shore); to deal with something as if by nibblingNIBBLING: to take away bit by bit (waves nibbling the shore); to deal with something as if by nibblingPALL: to dwindle (our enthusiasm soon palled)PALLED: to dwindle (our enthusiasm soon palled)PALLIATIVE: (n) something that palliates; (adj) serving to palliate, to moderate the intensity of (trying to palliate the boredom; did nothing to palliate the bitter disputes)PALLING: to dwindle (our enthusiasm soon palled)PARING: to diminish or reduce by or as if by paring (pare the novel down to a reasonable size)PEAK: to dwindle awayPEAKED: to dwindle awayPEAKING: to dwindle awayPRUNING: to reduce especially by eliminating superfluous matter (pruned the text, prune the budget); to remove as superfluous (prune away all ornamentation); to cut away what is unwanted or superfluousRAMP: to speed up, expand, decrease, or increase especially quickly or at a constant rate —used with up or downROLLBACK: the act or an instance of rolling back: to reduce or decrease something, specifically: to reduce (something, such as a commodity price) to or toward a previous levelTAIL: to grow progressively smaller, fainter, or more scattered: to abate —usually used with off (productivity is tailing off)TAILING: to grow progressively smaller, fainter, or more scattered: to abate —usually used with off (productivity is tailing off)TAME: to tone down: to soften (tamed the language in the play); to become tameTAMED: to tone down: to soften (tamed the language in the play); to become tameTAMELY: to tone down: to soften (tamed the language in the play); to become tameTAMING: to tone down: to soften (tamed the language in the play); to become tameTHIN: to make or become thin or thinner; to reduce in number or bulkTHINLY: in a thin manner: to make or become thin or thinner; to reduce in number or bulkTHINNING: to make or become thin or thinner; to reduce in number or bulkTRAIL: to dwindle (her voice trailing off)TUMBLE: an act or instance of tumbling; also, to decline suddenly and sharply (as in price): to drop (the stock market tumbled) WANE: the act or process of waning (his strength was on the wane); to decrease in size, extent, or degree: to dwindleWANED: the act or process of waning (his strength was on the wane); to decrease in size, extent, or degree: to dwindleWANING: the act or process of waning (his strength was on the wane); to decrease in size, extent, or degree: to dwindleWHITTLE: to reduce, remove, or destroy gradually as if by cutting off bits with a knife: to pare (whittle down expenses)WINNOW: to narrow, to reduce (winnowed the field to four contenders)WINNOWED: to narrow, to reduce (winnowed the field to four contenders)WINNOWING: to narrow, to reduce (winnowed the field to four contenders)
Degree: Great
AMPING: to make (something) more intense: to heighten, intensifyAMPLIFY: to make larger or greater (as in intensity): to increaseBADLY: to a great or intense degreeBLIND: —used as an intensive (was robbed blind)COOL: used as an intensive (a cool million dollars)DEADLY: very great: extreme (deadly serious)DEAL: a usually large or indefinite degree (a great deal of support, a good deal faster)ELEMENTAL: of, relating to, or resembling a great force of nature (the rains come with elemental violence, elemental passions)ELEMENTALLY: of, relating to, or resembling a great force of nature (the rains come with elemental violence, elemental passions)EMINENTLY: to a high degree: veryEVEN: to a degree that extends: fully, quite (faithful even unto death); also, —used as an intensive to stress the comparative degree (I did even better than before.)FULLY: in a full manner or degree: completely; at least (“fully 90% of people agreed”)GAIN: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GAINED: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GAINING: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GARGANTUAN: tremendous in size, volume, or degree: gigantic, colossal; named for Gargantua, a giant king in François Rabelais's 16th-century satiric novel GargantuaHEIGHTEN: to increase the degree of: augment; to become great or greater in degree or extentHEIGHTENING: to increase the degree of: augment; to become great or greater in degree or extentHIGH: of greater degree, amount, cost, value, or content than average, usual, or expected (high prices, speed, temperatures, etc.)HIGHLY: in or to a high degree or amountHUGE: great in scale or degreeJOLLY: veryLEVEL: the magnitude of a quantity considered in relation to an arbitrary reference value; broadly: magnitude, intensity (a high level of hostility)LIFETIME: an amount accumulated or experienced in a lifetime (a lifetime of regrets)LIMIT: the utmost extentLIVELY: active, intense (takes a lively interest in politics)LONG: possessing a high degree or a great deal of something specified: strong (long on common sense)MADE: to amount to in significance (makes a great difference)MADLY: to an extreme or excessive degreeMAJOR: prominent or significant in degree (earned some major cash)MAJORLY: extremely, in an extreme mannerMAKE: to amount to in significance (makes a great difference)MAKING: to amount to in significance (makes a great difference)MIGHTILY: very muchMIGHTY: extremely, veryMILE: a relatively great degree usually plural (was miles ahead of them in education; This one is miles [=much, far] better than that one.)MONDO: extremely; from reanalysis of mondo in title of the American film Mondo Bizarro (1966), after the Italian film Mondo cane (1962)MORTAL: marked by great intensity or severity (mortal fear)MUCH: great in quantity, amount, extent, or degree; a great quantity, amount, extent, or degreeMUCHO: to a high degree: veryMULTIPLY: (adv.) in a multiple manner: in several ways (multiply talented children)NOTABLY: in a notable manner: to a high degree; especially, particularlyOPTIMA: plural of optimum: the greatest degree attained or attainable under implied or specified conditionsPEAK: the highest level or greatest degree (a singer at the peak of her popularity); being at or reaching the maximum (peak performance); also: of, relating to, or being a period of maximum intensity or activity; being at the height of popularity, use, or attention —used before the name of a product, person, cultural trend, etc.; also, a high point in a course of development especially as represented on a graph (crime reached a peak two years ago) also, to reach a maximum (as of capacity, value, or activity) —often used with out; to cause to come to a peak, point, or maximumPEAKED: the highest level or greatest degree (a singer at the peak of her popularity); being at or reaching the maximum (peak performance); also: of, relating to, or being a period of maximum intensity or activity; being at the height of popularity, use, or attention —used before the name of a product, person, cultural trend, etc.; also, a high point in a course of development especially as represented on a graph (crime reached a peak two years ago) also, to reach a maximum (as of capacity, value, or activity) —often used with out; to cause to come to a peak, point, or maximumPEAKING: the highest level or greatest degree (a singer at the peak of her popularity); being at or reaching the maximum (peak performance); also: of, relating to, or being a period of maximum intensity or activity; being at the height of popularity, use, or attention —used before the name of a product, person, cultural trend, etc.; also, a high point in a course of development especially as represented on a graph (crime reached a peak two years ago) also, to reach a maximum (as of capacity, value, or activity) —often used with out; to cause to come to a peak, point, or maximumPINK: highest degree possible: height (keep their house in the pink of repair)PLAIN: absolutely (plain wrong)PLAINLY: absolutely (plain wrong)QUITE: to a considerable extent: rather (quite near); to an extreme: positively (quite sure)RIGHT: to a great degree: very (a right pleasant day)ROARING: great in intensity or degree (a roaring success); extremely (… was roaring hungry)ROYAL: of superior size, magnitude, or quality (a home of royal dimensions); often used as an intensive (a royal pain)ROYALLY: informal: to a high degree —used as an intensiveTALL: large or formidable in amount, extent, or degree (a tall order to fill)UNDUE: exceeding or violating propriety or fitness: more than is reasonable or necessary: excessiveUNDULY: in an undue manner: excessively (an unduly harsh punishment, unduly sensitive)VIOLENT: extreme, intense (violent pain, violent colors)WELL: to a high degree (well deserved the honor, a well-equipped kitchen); fully, quite (well worth the price); also, —often used as an intensifier or qualifier (He had been happy pretty well all the time.); to a large extent or degree: considerably, far (well over a million)WILDLY: extremely, to an extreme extent (wildly popular, wildly enthusiastic)
Degree: Moderate
FAIRLY: so to speak: nearly, practically (fairly bursting with pride); rather, in some degree, somewhat, moderately (a fairly easy job)GENTLE: moderate (His doctor recommended gentle exercise.)KINDA: a “pronunciation spelling” used for "kind of" in informal speech and in representations of such speech; to a moderate degree: somewhat; in a way that approximates: more or lessLIKE: (adv.) to some extent: rather, altogether (saunter over nonchalantly like); nearly, approximately (the actual interest is more like 18 percent);MEAN: occupying a middle position: intermediate in space, order, time, kind, or degree; something intervening or intermediateMEDIUM: intermediate in quantity, quality, position, size, or degreeMIDDLING: of middle, medium, or moderate size, degree, or qualityMILD: moderate in action or effect (a mild sedative)PARTLY: in some measure or degree: partially, to some extent: in some degree
Degree: Slight or None
BEAN: beans plural: the least amount (didn't know beans about it)DAMN: a minimum amount or degree (as of care or consideration): the least bit (don't give a damn)DROP: a minute quantity or degree of something nonmaterial or intangible (not a drop of meanness in her)HAIR: a precise degree: aligned to a hairHARDLY: used to emphasize a minimal amount or degreeHOOT: a minimum amount or degree: the least bit (don't give a hoot)INCH: a small amount, distance, or degreeLICK: a small amount: a bit (couldn't swim a lick)LIGHTLY: in a small degree or amount (lightly salted food)LITTLE: not much: existing only to a slight degree; in only a small degree: slightly; not at all MEAN: worthy of little regard: contemptible —often used in negative constructions as a term of praise (no mean feat)MINOR: inferior in degree: comparatively unimportantNEGLIGIBLE: so small or unimportant or of so little consequence as to warrant little or no attention: triflingNOHOW: in no manner or way: not at all (was nohow equal to the task)NOMINAL: trifling, insignificant (charged only nominal rent)WHOOP: a minimum amount or degree: the least bit (not worth a whoop)
Degree: Unspecified
LENGTH: the degree to which something (such as a course of action or a line of thought) is carried, often used in plural (went to great lengths to learn the truth)PITCH: the relative level, intensity, or extent of some quality or state (tensions rose to a feverish pitch)
Dimension general bulk and magnitude; not shape
BIGLY: large or great in dimensions, bulk, or extentBULK: magnitude (impressed by the sheer bulk of her accomplishment)GAGE: M-W: less common spelling of gauge: dimensions, sizeGARGANTUAN: tremendous in size, volume, or degree: gigantic, colossal; named for Gargantua, a giant king in François Rabelais's 16th-century satiric novel GargantuaGAUGE: MW: or less commonly gage: dimensions, sizeGIANT: something unusually large or powerful; also, having extremely large size, proportion, or powerGIGANTIC: exceeding the usual or expected (as in size, force, or prominence)GIRTH: size or dimensionsHUGE: very large or extensive; of great size or area; great in scale or degreeNOTHING: the absence of all magnitude or quantityPROPORTION: size: physical magnitude, extent, or bulk: relative or proportionate dimensions; also, to adjust (a part or thing) in size relative to other parts or things; also, harmonious relation of parts to each other or to the whole: balance, symmetry; also, to make the parts of [something] harmonious or symmetricalPROTRACT: to extend forward or outwardPROTRACTOR: one that protracts: to extend forward or outwardTHICK: having or being of relatively great depth or extent from one surface to its opposite; in a thick manner: thickly; the part of greatest thickness (the thick of the thumb)THIN: having little extent from one surface to its opposite (thin paper); also, to make or become thin or thinner; to reduce in thickness or depth: to attenuateTHINLY: in a thin manner: having little extent from one surface to its opposite (thin paper); also, to make or become thin or thinner; to reduce in thickness or depth: to attenuateTHINNING: having little extent from one surface to its opposite (thin paper); also, to make or become thin or thinner; to reduce in thickness or depth: to attenuate
Equal
ALIKE: in the same manner, form, or degree: equally; exhibiting close resemblance without being identicalEQUAL: of the same measure, quantity, amount, or number as another; also, an equal quantity; also, to be equal to; especially: to be identical in value toEQUALED: of the same measure, quantity, amount, or number as another; also, an equal quantity; also, to be equal to; especially: to be identical in value toEVEN: equal, fair; being in equilibrium; also, to make even; to become evenEVENED: equal, fair; being in equilibrium; also, to make even; to become even EVENER: one that makes evenEVENING: equal, fair; being in equilibrium; also, to make even; to become evenEVENLY: in an even manner or degree: in equal parts (a career evenly divided between stage and screen) (divided the cake evenly into four parts)PARITY: the quality or state of being equal or equivalentPART: one of several or many equal units of which something is composed or into which it is divisible: an amount equal to another amount (mix one part of the powder with three parts of water)TANTAMOUNT: equivalent in value, significance, or effectTIED: to provide or offer something equal to: to equalTYING: to provide or offer something equal to: to equalWORTH: the equivalent of a specified amount or figure (a dollar's worth of gas); equal in value to (what’s it worth?)
Estimates
AROUND: with some approach to exactness: approximately (e.g., it costs around $5)CALCULATE: to estimateEYEBALL: to measure or estimate roughly by sightEYEBALLED: to measure or estimate roughly by sightMINIMIZATION: to underestimate intentionallyMINIMIZE: to underestimate intentionallyMINIMIZED: to underestimate intentionallyMINIMIZING: to underestimate intentionallyPLACE: to estimate (placed the value of the estate too high)RATABILITY: the quality or state of being ratable: capable of being rated, estimated, or apportionedROUGH: approximate (a rough idea) (an estimate)ROUNDING: approximately correct, especially: exact only to a specific decimal or place (use the round number 1400 for the exact figure 1411); also, to express as a round number —often used with off (11.3572 rounded off to two decimal places becomes 11.36)VICINITY: an approximate amount, extent, or degree (in the vicinity of ten thousand attendees)
Extent: Limited
CAPPED: to prevent from growing or spreading: set an upper limit on CAPPING: to prevent from growing or spreading: set an upper limit on FINITE: completely determinable in theory or in fact by counting, measurement, or thought (e.g., the finite velocity of light)FINITUDE: finite quality or stateLIMIT: a prescribed maximum or minimum amount, quantity, or number; limitationLINE: limit, restraint (overstepped the line of good taste)MAXIMA: plural of maximum, an upper limit allowed (as by a legal authority) or allowable (as by the circumstances of a particular case)MAXIMAL: being an upper limit: highestMINIMA: plural of minimum, the least quantity assignable, admissible, or possible; the lowest degree or amount of variation reached or recordedMINIMAL: relating to or being a minimum: such as the least possible; very small or slight (a minimal interest in art)MINIMUM: the least quantity assignable, admissible, or possible; the lowest degree or amount of variation reached or recordedNARROW: limited in size or scopeNARROWLY: limited in size or scopeTHIN: not dense in arrangement or distribution (thin hair); also, to make or become thin or thinner; to reduce in thickness or depth: to attenuateTHINLY: in a thin manner: not dense in arrangement or distribution (thin hair); also, to make or become thin or thinner; to reduce in thickness or depth: to attenuateTHINNING: not dense in arrangement or distribution (thin hair); also, to make or become thin or thinner; to reduce in thickness or depth: to attenuateWITHIN: not beyond the quantity, degree, or limitations of (live within your income); —used as a function word to indicate a specified difference or margin (came within two points of a perfect mark, within a mile of the town)
Extent: Maximum
AUGHT: anything, all, everythingCAPACITY: the maximum amount or number that can be contained or accommodatedLIMIT: a prescribed maximum or minimum amount, quantity, or numberMARGIN: a bare minimum below which or an extreme limit beyond which something becomes impossible or is no longer desirable (the margin of good taste)MAXIMA: plural of maximum, the greatest quantity or value attainable or attainedMAXIMAL: being an upper limit: highestOPTIMA: plural of optimum: the greatest degree attained or attainable under implied or specified conditionsPRIMARILY: for the most part: chieflyROYAL: of superior size, magnitude, or quality (a home of royal dimensions)TALL: large or formidable in amount, extent, or degree (a tall order to fill)TEEM: to become filled to overflowing: to abound; to be present in large quantityTEEMED: to become filled to overflowing: to abound; to be present in large quantityTEEMING: to become filled to overflowing: to abound; to be present in large quantityWHOLE: very great in quantity, extent, or scope (feels a whole lot better now)WORLD: an indefinite multitude or a great quantity or distance (makes a world of difference)
Extent: Minimum
LIMIT: a prescribed maximum or minimum amount, quantity, or numberMARGIN: a bare minimum below which or an extreme limit beyond which something becomes impossible or is no longer desirable (the margin of good taste)MINIMA: plural of minimum, the least quantity assignable, admissible, or possible; the lowest degree or amount of variation reached or recordedMINIMAL: relating to or being a minimum: such as the least possible; very small or slight (a minimal interest in art)MINIMIZATION: to reduce or keep to a minimumMINIMIZE: to reduce or keep to a minimumMINIMIZED: to reduce or keep to a minimumMINIMIZING: to reduce or keep to a minimumMINIMUM: the least quantity assignable, admissible, or possible; the lowest degree or amount of variation reached or recordedPEANUT: insignificant, petty (peanut politics)
Extent: Unlimited
INFINITE: extending indefinitely to infinity: endless; immeasurably or inconceivably great or extensive: inexhaustible; extending beyond, lying beyond, or being greater than any preassigned finite value however largeINFINITUDE: the quality or state of being infinite: infiniteness; something that is infinite especially in extentINFINITY: the quality of being infinite; unlimited extent of time, space, or quantity: boundlessnessOCEAN: a very large or unlimited quantity or expanse OVER: having or showing an excess or surplus; excessive (over imagination); in an excessive manner: inordinately (over-confident contestants); also, beyond some quantity, limit, or norm often by a specified amount or to a specified degree (show ran a minute over) (a condition common in people 65 and over); also, remaining and not used (had some money left over); not used up: remaining (leave something over just in case)RIOT: a random or disorderly profusion (the woods were a riot of color) SEAS: something likened to the sea especially in vastness (a sea of faces)UNCOUNTED: innumerable: too many to be numbered: countless; also: very manyUNDUE: exceeding or violating propriety or fitness: more than is reasonable or necessary: excessiveUNDULY: in an undue manner: excessively (an unduly harsh punishment, unduly sensitive)
Extent: Unspecified
INDEFINITE: having no exact limitTRACT: an area either large or small
Imprecise, Inexact, Approximate
ABOUT: reasonably close to; almost (in number, etc.)AROUND: with some approach to exactness: approximately (e.g., it costs around $5)INDEFINITE: not precise: vagueINEXACT: not precisely correct or true: inaccurateKINDA: a “pronunciation spelling” used for "kind of" in informal speech and in representations of such speech; to a moderate degree: somewhat; in a way that approximates: more or lessLEEWAY: an allowable margin of freedom or variation: toleranceLIKE: nearly, approximately (the actual interest is more like 18 percent);MARGIN: a measure or degree of difference (the bill passed by a one-vote margin)MUCH: nearly, approximately (looks much the way his father did)NOMINAL: of, being, or relating to a designated or theoretical size that may vary from the actual: approximate (the pipe's nominal size)UNBOUNDED: having no limit (unbounded enthusiasm/joy)UNKNOWN: having an unknown value (an unknown quantity)
Increase, Augment quantity, extent, size, or degree
ACCRUAL: the action or process of accruing something; something that accrues or has accruedACCRUING: to accumulate or be added periodicallyACCUMULATE: to gather or pile up especially little by little: amassADDED: to join or unite so as to bring about an increase or improvementADDENDA: plural of addendum: a thing added: additionADDING: to join or unite so as to bring about an increase or improvementADDITION: to join or unite so as to bring about an increase or improvementADDITIONAL: more than is usual or expected: addedADDITIVE: of, relating to, or characterized by additionADJUNCT: something joined or added to another thing but not essentially a part of itALONG: in addition: also (usually used with with, e.g., a bill came along with the package)AMPLIFY: to make larger or greater (as in amount, importance, or intensity): to increase the amount ofAUGMENT: to make greater, more numerous, larger, or more intense; to supplement; also, to become augmentedBEEF: to increase or add substance, strength, or power to —usually used with upBEEFED: to increase or add substance, strength, or power to —usually used with upBUILD: to increase, enlarge (helps build muscle, build support for their candidate); to develop in extent (a crowd building); to progress toward a peak (as of intensity) (build to a climax)BUILDING: to increase, enlarge (helps build muscle, build support for their candidate); to develop in extent (a crowd building); to progress toward a peak (as of intensity) (build to a climax)BUILT: to increase, enlarge (helps build muscle, build support for their candidate); to develop in extent (a crowd building); to progress toward a peak (as of intensity) (build to a climax)BULK: to swell, expandBUMP: an increase in amount (a slight bump in wages/prices)CENTUPLE: (adj) being 100 times as large, as great, or as many as some understood size, degree, or amount : very great —usually preceded by a, an, or a numeral (as one, four); also, (adv) by 100 times (increased a hundredfold, increased one hundredfold), —usually preceded by a, an, or a numeral (as one, four); also, (v) to centuplicate: to make 100 times as much or as many: to centupleCLIMB: to increase gradually (prices are continuing to climb)DILATION: the act or action of enlarging, expanding, or widening: the state of being dilated; the condition of being stretched or enlarged beyond normal dimensionsENHANCE: heighten, increase; especially: to increase or improve in value, quality, desirability, or attractivenessENHANCED: heighten, increase; especially: to increase or improve in value, quality, desirability, or attractivenessENHANCEMENT: heighten, increase; especially: to increase or improve in value, quality, desirability, or attractivenessENHANCING: heighten, increase; especially: to increase or improve in value, quality, desirability, or attractivenessEXPAND: to increase the extent, number, volume, or scope of: to enlarge; to increase in extent, number, volume, or scopeEXPANDED: to increase the extent, number, volume, or scope of: to enlarge; to increase in extent, number, volume, or scopeFIVEFOLD: being five times as great or as manyGAIN: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GAINED: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GAINING: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GROW: to increase, to expand (grows in wisdom)GROWING: to increase, to expand (grows in wisdom)GROWN: to increase, to expand (grows in wisdom)HEIGHTEN: to increase the amount or degree of: augment; to become great or greater in amount, degree, or extentHEIGHTENING: to increase the amount or degree of: augment; to become great or greater in amount, degree, or extentHIKE: to raise in amount sharply or suddenlyHIKED: to raise in amount sharply or suddenlyHIKING: to raise in amount sharply or suddenlyINFLATE: to expand or increase abnormally or imprudentlyINFLATING: to expand or increase abnormally or imprudentlyJACK: to raise the level or amount of (something, such as prices): to increase, to jack upLARD: to augment or intersperse especially with something superfluous or excessive (the book is larded with subplots)LIFT: to raise in rate or amountLIFTING: to raise in rate or amountMOUNT: to increase in amount or extent (expenses began to mount)MOUNTED: to increase in amount or extent (expenses began to mount)MULTIPLY: to increase in number especially greatly or in multiples; to augmentPUMP: to pour forth, deliver, or draw with or as if with a pump (pumped money into the economy)PUMPED: to pour forth, deliver, or draw with or as if with a pump (pumped money into the economy)PUMPING: to pour forth, deliver, or draw with or as if with a pump (pumped money into the economy)RAKING: to gain rapidly or in abundance —usually used with in (rake in a fortune)RAMP: to speed up, expand, decrease, or increase especially quickly or at a constant rate —used with up or downTAKEOFF: a rapid rise in activity, growth, or popularity (an economic takeoff)TAMP: to put a check on : reduce, lessen (tamp down rumors)THICKEN: to increase the depth or diameter ofTWICE: two times: in doubled quantity or degreeTWOFOLD: being twice as great or as manyUPPED: to increase (upped prices)UPPING: to increase (upped prices)ZOOM: to increase sharply (retail sales zoomed)ZOOMED: to increase sharply (retail sales zoomed)
Precise, Exact
AROUND: with some approach to exactness: approximately (e.g., it costs around $5)CLEAN: characterized by clarity and precision: trim (a clean prose style; architecture with clean almost austere lines)CLOCKWORK: the precision, regularity, or absence of variation associated with a clock or clockwork (a clockwork operation) ; —used in the phrase like clockwork to describe something that happens or works in a regular and exact wayDAINTILY: marked by fastidious discrimination or finicky taste; showing avoidance of anything roughDAINTY: marked by fastidious discrimination or finicky taste; showing avoidance of anything roughDEAD: absolutely uniform (a dead reckoning); unerring (a dead shot with a rifle); exact (dead center of the target)DEADLY: absolutely uniform (a dead reckoning); unerring (a dead shot with a rifle); exact (dead center of the target)EVEN: exact, precise (an even dollar); exactly, precisely; to make even; to become even; also, to make even; to become evenEVENED: exact, precise (an even dollar); exactly, precisely; to make even; to become even; also, to make even; to become evenEVENING: exact, precise (an even dollar); exactly, precisely; to make even; to become even; also, to make even; to become evenEXACT: exhibiting or marked by strict, particular, and complete accordance with fact or a standard; marked by thorough consideration or minute measurement of small factual details; also, to call for as necessary or desirableFINE: very precise or accurate (a fine adjustment); delicate, subtle, or sensitive in quality, perception, or discrimination (a fine distinction)HAIR: a precise degree: aligned to a hairLAPIDARY: having the elegance and precision associated with inscriptions on monumental stone (e.g., a stanza that has a lapidary dignity)MEET: to conform to, especially with exactitude and precision (a concept to meet all requirements)MEETING: to conform to, especially with exactitude and precision (a concept to meet all requirements)NEAT: marked by skill or ingenuity: adroit (a neat trick); precise, systematic (mathematics … retains the neat exactness of the surgeon's knife)NICE: possessing, marked by, or demanding great or excessive precision and delicacy (nice measurements, a nice distinction between these two words); exacting in requirements or standards: punctilious (a nice code of honor); showing fastidious or finicky tastes: particular (too nice a palate to enjoy junk food)NICELY: possessing, marked by, or demanding great or excessive precision and delicacy (nice measurements, a nice distinction between these two words); exacting in requirements or standards: punctilious (a nice code of honor); showing fastidious or finicky tastes: particular (too nice a palate to enjoy junk food)NICETY: an elegant, delicate, or civilized feature (enjoy the niceties of life); a fine point or distinction: subtlety (the niceties of table manners); careful attention to details: delicate exactness: precision; delicacy of taste or feeling: fastidiousnessPINPOINT: extremely fine or precise
Quantity: General Terms
AMOUNT: the total number or quantity: aggregate EASY: easily: without question: by far (cost $500 easy); also, at the minimum: at least (cost $500 easy)GOING: present participle of to go, to yield, to weigh (This fish goes ten pounds.)GONE: past participle of to go, to yield, to weigh (This fish goes ten pounds.)LEVEL: the magnitude of a quantity considered in relation to an arbitrary reference value; broadly: magnitude, intensity (a high level of hostility)QUANTA: plural of quantum: quantity, amount; gross quantity: bulkTUNE: amount, extent (custom-made to the tune of $40 to $50 apiece)WENT: past tense of to go, to yield, to weigh (This fish goes ten pounds.)WHAT: the … that : as much or as many … as (rescued what survivors they found)
Quantity: Little or Less Than
ATOM: a tiny particle: a bitATTRITION: a reduction in numbers usually as a result of resignation, retirement, or deathBEAN: beans plural: the least amount (didn't know beans about it)CHANGE: a negligible additional amount (only six minutes and change left in the game)DECAY: a decrease in quantity, activity, or force; also, to decrease usually gradually in size, quantity, activity, or forceDECAYED: a decrease in quantity, activity, or force; also, to decrease usually gradually in size, quantity, activity, or forceDECIMATE: to reduce drastically especially in number (cholera decimated the population)DECIMATED: to reduce drastically especially in number (cholera decimated the population)DIDDLY: slang: short for diddly-squat, the least amount: anything at allDOLLOP: a small quantity; a small lump, portion, or amountDRAB: a small amount —usually used in the phrase dribs and drabsDRIB: a small amount —usually used in the phrase dribs and drabsDROP: a minute quantity or degree of something nonmaterial or intangible (not a drop of meanness in her)EVEN: —used as an intensive to indicate a small or minimum amount (didn't even try)GRAIN: the least amount possible (a grain of truth)HINT: a very small amount: a suggestion (prepared with just a hint of spice)IOTA: an infinitesimal amount: a jotLITTLE: a small amount or quantity (she ate a little); not much; not much: existing only in a small amount; in only a small quantityMICRO: involving minute quantities or variationsMINIMA: plural of minimum, the least quantity assignable, admissible, or possibleMINIMUM: the least quantity assignable, admissible, or possibleMINORITY: the smaller quantity or shareMITE: a very little: a bitMODICUM: a small portion: a limited quantityMOTE: a small particle: a speckONLY: few (one of the only areas not yet explored); at the very least (it was only too true)OUNCE: a small amount (an ounce of sense)PENNY: a trivial amountPINCH: as much as may be taken between the finger and thumb (a pinch of snuff)PITTANCE: a small portion, amount, or allowanceTANG: a faint suggestion: a trace (my comment held a tang of sarcasm)THIN: few in number: scarce; scantily supplied; having less than the usual number: scanty (thin attendance, thinly attended); to reduce in number or bulkTHINLY: in a thin manner: few in number: scarce; scantily supplied; having less than the usual number: scanty (thin attendance, thinly attended); to reduce in number or bulkTHINNING: few in number: scarce; scantily supplied; having less than the usual number: scanty (thin attendance, thinly attended); to reduce in number or bulkTICK: a small amountTOUCH: something slight of its kind; a small quantity or indication: a hint (a touch of spring in the air); also, a near approach: a close call (beaten in the championships by a mere touch)TRAIT: a touch, a traceTRILLIONTH: a minute partVAGUE: slight (a vague hint of vanilla) (hasn't the vaguest idea)VAGUELY: in a vague way: somewhat or slightly (He's vaguely familiar with the area.)WHIFF: a slight trace or indication (a whiff of scandal)WHIT: the smallest part or particle imaginable: a bit
Quantity: Medium or Middling
MEDIUM: intermediate in quantity, quality, position, size, or degreeMIDDLING: of middle, medium, or moderate size, degree, or quality
Quantity: Much or More Than
ABOVE: exceeding in number, quantity, or size: more thanAMPING: to increase the amount of (something): to raiseAMPLIFY: to make larger or greater in amount: to increase the amount ofARRAY: an imposing group: a large numberBATH: a flood, an overwhelming quantity or volume; also: a state of abundant flow or volume or of greatest activityBONANZA: a very large amountBRUNT: the greater part: burdenDEAL: a usually large or indefinite quantity (a good deal more)DOZEN: an indefinitely large number (dozens of times)EXPAND: to increase the extent, number, volume, or scope of: to enlarge; to increase in extent, number, volume, or scopeEXPANDED: to increase the extent, number, volume, or scope of: to enlarge; to increase in extent, number, volume, or scopeFLOOD: an overwhelming quantity or volume FLOODED: an overwhelming quantity or volume FLOODING: an overwhelming quantity or volume GAGGLE: an indefinite numberGOODLY: significantly large: considerable: a goodly numberHEALTHY: of quantity: not small or feeble: considerableHEAP: a great number or large quantity: a lotHEAVY: of unusually large size or amount: a heavy turnoutHIGH: of greater degree, amount, cost, value, or content than average, usual, or expected (high prices, speed, temperatures, etc.)INFINITE: characterized by an infinite number of elements or termsINFINITUDE: an infinite number or quantityINFINITY: unlimited quantity; an indefinitely great number or amountLEGION: a very large number: a multitude; also, (adj.) many, numerousLIFT: to raise in rate or amountLIFTING: to raise in rate or amountLOAD: a large quantity: a lot —usually used in plural (The boy had loads of toys.)LONG: consisting of a greater number or amount than usual: large; larger or longer than the standard (a long count by the referee)MACRO: of, involving, or intended for use with relatively large quantitiesMAJOR: greater in quantity; prominent or significant in amountMANY: a large but indefinite number; consisting of or amounting to a large but indefinite number; a large number of persons or thingsMANY: the great majority of people; or being one of a large but indefinite numberMILLION: a very large numberMONDO: very large or great in amount or number; from reanalysis of mondo in title of the American film Mondo Bizarro (1966), after the Italian film Mondo cane (1962)MOUND: a heap, pile, a large quantity (mounds of work)MUCH: great in quantity, amount, extent, or degree; a great quantity, amount, extent, or degreeMUCHO: a lot of: muchMULTIMILLION: being, involving, or worth many millions (as of dollars or pounds)MYRIAD: a great number; innumerable OVER: more than (cost over $5, waited over an hour, they had well over 200 people at their wedding); also, beyond some quantity, limit, or norm often by a specified amount or to a specified degree (show ran a minute over) (a condition common in people 65 and over); also, remaining and not used (had some money left over); not used up: remaining (leave something over just in case)PECK: a large quantity or numberPILE: any great number or quantity: a lot (she’s got a pile of canoes)PLATEFUL: a large number or amount (a plateful of problems)TALL: large or formidable in amount, extent, or degree (a tall order to fill)TEEM: to become filled to overflowing: to abound; to be present in large quantityTEEMED: to become filled to overflowing: to abound; to be present in large quantityTEEMING: to become filled to overflowing: to abound; to be present in large quantityTHICK: occurring in large numbers: numerous; close-packed with units or individuals (the air was thick with snow) THICKEN: to become concentrated in numbers, mass, or frequencyTIDE: a large and increasing quantity or volume (a tide of opportunists, a swelling tide of criticism)TIDILY: large, substantial (a tidy profit)TIDY: large, substantial (a tidy profit)TONNAGE: an impressively large amount or weightUMPTEEN: very many: indefinitely numerous; blend of umpty (such and such) and -teen (as in thirteen)UNCOUNTED: innumerable: too many to be numbered: countless; also: very manyUNDUE: exceeding or violating propriety or fitness: more than is reasonable or necessary: excessiveUNDULY: in an undue manner: excessively (an unduly harsh punishment, unduly sensitive)WHOLE: very great in quantity, extent, or scope (feels a whole lot better now)YARD: a great length or quantity (remembered yards of facts and figures)
Quantity: Nothing
AUGHT: zero, cipherJACK: US slang: anything at all —used in negative constructions (e.g., “doesn’t know jack”NADA: nothingNARY: dialect: not any: not one [alteration of ne'er a]NAUGHT: or less commonly nought: nothing (Their efforts came to naught. It was all for naught.)NEGLIGIBLE: so small or unimportant or of so little consequence as to warrant little or no attention: triflingNOMINAL: trifling, insignificant (charged only nominal rent)NONE: not any; not any such thing; no part: nothing; by no means: not at all (none too soon to begin); in no way: to no extent (none the worse for wear)NOTHING: not any thing: no thing; no part; not at all: in no degree; the absence of all magnitude or quantity; zeroNOUGHT: or more commonly naught: nothing (Their efforts came to naught.)NULL: amounting to nothing: nil; of, being, or relating to zero (The meter gave a null reading.); ; also, to make null
Ranks, Levels, Stages, Steps not numbers
ABOVE: in or to a higher rank or numberALPHA: something or someone designated with the name alpha or the Greek letter α especially denoting the first in position, order, or classALPHA: something that is first: beginning (alpha and omega); something or someone designated with the name alpha or the Greek letter α especially denoting the first in position, order, or classANTE: a level (as of achievement or intensity) regarded especially as a goal or standardARCH: principal, chief (e.g., arch enemy)ARRANGING: to put into a proper order or into a correct or suitable sequence, relationship, or adjustmentBELOW: in, to, at, or by a lower rank or number; lower in place, rank, or value than: underBETA: something or someone designated with the name beta or the Greek letter β especially denoting the second in position, order, or classBILLIONTH: (noun) number one billion in a countable series; also, (adj.) being number one billion in a countable seriesBOTTOM: the lowest or last place in rank or positionBUMP: a demotion, reduction to a lower grade or rank or relegation to a less important position (was bumped down to assistant manager); also, to move (someone or something) to a different level, position, rank, etc. (rates being bumped up) (The team got bumped out of first place.); to remove (someone or something) usually by virtue of seniority or priorityBUMPING: a demotion, reduction to a lower grade or rank or relegation to a less important position (was bumped down to assistant manager); also, to move (someone or something) to a different level, position, rank, etc. (rates being bumped up) (The team got bumped out of first place.); to remove (someone or something) usually by virtue of seniority or priorityCAME: to advance, rise, or improve in rank or condition (has come a long way); to approach in kind or quality (this comes close to perfection.)CAPPED: to follow with something more noticeable or more significant: outdoCAPPING: to follow with something more noticeable or more significant: outdoCOME: to advance, rise, or improve in rank or condition (has come a long way); to approach in kind or quality (this comes close to perfection.)COMING: to advance, rise, or improve in rank or condition (has come a long way); to approach in kind or quality (this comes close to perfection.)CONCATENATE: (adj.) linked together; also, to link together in a series or chainECHELON: one of a series of levels or grades in an organization or field of activity (involved employees at every echelon); also, a group of individuals at a particular level or grade in an organization or field of activity (the upper echelons of management); also, any unit or group acting in a disciplined or organized mannerEMULATE: to strive to equal or excel; to equal or approach equality withENDED: to reach a specified ultimate rank, situation, or place —usually used with up (ended up as a colonel)ENDING: to reach a specified ultimate rank, situation, or place —usually used with up (ended up as a colonel)FINAL: coming at the end: being the last in a series, process, or progress (the final chapter, final exams)FINALLY: as the last act or occurrence in a series: in the end: eventually (and finally, after the instrumentalists, the singer came on the stage)GAMUT: the whole series of recognized musical notes; also, an entire range or series (ran the gamut from praise to contempt); Middle English gamut, gamma-ut "lowest note in the medieval hexachord system, the system itself," borrowed from Medieval Latin, from gamma (used as a symbol for the lowest note in the scale) + ut (a syllable used for the first note in the diatonic scale in an early solmization system and later replaced by do)GAUNTLET: a line, series, or assemblageGRADING: to arrange in grades: to sort; also, to arrange in a scale or seriesGRAND: having higher rank than others bearing the same general designation (the grand champion)HIGH: foremost in rank, dignity, or standing (high officials); also, near or at the top of a range (temperatures in the high 80s); also, a point or level of greater amount, number, or degree than average or expected: a high point or level (sales reached a new high) (mostly sunny with highs in the 80s) (the highs and lows of her career)INAUGURAL: first in a projected seriesINITIAL: placed at the beginning: firstITEM: a distinct part in an enumeration, account, or series: article; also, “and in addition”: meaning “also” (used to introduce each article in a list or enumeration)LEAD: to be first in or among (lead the league); to be first (This state leads in population.); to begin, to open (lead off with announcements)LEVEL: a position in a scale or rank (as of achievement, significance, or value) (funded at the national level); suited to a particular rank or plane of ability or achievement (top-level thinking); equal in advantage, progression, or standingLINE: a chronological series; also, an arrangement or placement of persons or objects of one kind in an orderly series (a line of trees, waiting in line); also: the persons or objects so positioned (the line moved slowly at the bank); also, to place or form a line along (pedestrians line the walks); to form into a line or lines; to align (line up troops); also, to come into the correct relative position; to alignLINED: to place or form a line along (pedestrians line the walks); to form into a line or lines; to align (line up troops); also, to come into the correct relative position; to alignLINING: to place or form a line along (pedestrians line the walks); to form into a line or lines; to align (line up troops); also, to come into the correct relative position; to alignLONG: containing many items in a series (a long list)MAJOR: greater in dignity, rank, importance, or interest (one of the major poets); one that is superior in rank, importance, size, or performance (economic power of the oil majors)MARK: an assessment of merits: rating (high marks for honesty); a standard of performance, quality, or condition: norm (up to the mark); a figure registering a point or level reached or achievedMEGA: of the highest level of rank, excellence, or importance (a number one hit made her mega)MEGAHIT: something (such as a movie) that is extremely successfulMIDDLING: of, relating to, or being a middle classMINT: to cause to attain an indicated status (newly minted doctors)MINTED: to cause to attain an indicated status (newly minted doctors)MINTING: to cause to attain an indicated status (newly minted doctors)MULTILEVEL: having more than one level: such as having a scale (as of difficulty or achievement) with multiple positions or ranksNEXT: one that is next (from one day to the next)NOTCH: a degree or step; also, score or achieve —sometimes used with upNOTCHED: a degree or step; also, score or achieve —sometimes used with upOMEGA: the extreme or final part: the end; also, something or someone designated with the name omega or the Greek letter ω especially denoting the last in position, order, or classPENULT: the next to the last member of a seriesPINNACLE: the highest point of development or achievement: acmePITCH: to cause to be at a particular level or of a particular quality (a test pitched at a 5th-grade reading level)PITCHED: to cause to be at a particular level or of a particular quality (a test pitched at a 5th-grade reading level)PITCHING: to cause to be at a particular level or of a particular quality (a test pitched at a 5th-grade reading level)PLACE: the position of a figure in relation to others of a row or series; also, a relative position in a scale or series; also, a step in a sequence (in the first place, it's none of your business); also, to assign to a position in a series or category: to rankPLAT: plateau [by shortening]: a level of attainment or achievement; also, to reach a level, period, or condition of stability or maximum attainmentPLATEAU: a level of attainment or achievement; also, to reach a level, period, or condition of stability or maximum attainmentPOINT: a particular step, stage, or degree in development (had reached the point where nothing seemed to matter anymore); also, a definite position in a scalePRIMARILY: in the first place: originallyPRIMO: in the first placePRIOR: taking precedence (as in importance)PRIORITY: superiority in rank, position, or privilegeRANGING: to set in a row or in the proper order; to place among others in a position or situation; to take a positionRANK: a row, a series; an orderly arrangement: a formation; also, to arrange in lines or in a regular formation; also, to determine the relative position of: to rate; a grade of official standing in a hierarchy; also, the order according to some statistical characteristic (such as the score on a test); also, to take or have a position in relation to others (she ranks first in her class); also, relative standing or position; also, to determine the relative position of: to rateRANKING: a row, a series; an orderly arrangement: a formation; also, to arrange in lines or in a regular formation; also, to determine the relative position of: to rate; a grade of official standing in a hierarchy; also, the order according to some statistical characteristic (such as the score on a test); also, to take or have a position in relation to others (she ranks first in her class); also, relative standing or position; also, to determine the relative position of: to rate; also, (adj.) having a high position; of the highest rank (the ranking officer); (adj.) being next to the chairman in seniority (the ranking committee member)RATABILITY: the quality or state of being ratable: capable of being rated, estimated, or apportionedRUNG: a level in a hierarchy (climbing the social ladder one rung at a time)RUNNING: to be in a certain order of successionTACTIC: of or relating to arrangement or orderTOPPING: highest in rank or eminenceUMPTEENTH: latest or last in an indefinitely numerous series; from umpteen, ; blend of umpty (such and such) and -teen (as in thirteen)UPPED: to promote: to advance in station, rank, or honor: to raise; to advance to a higher levelUPPING: to promote: to advance in station, rank, or honor: to raise; to advance to a higher levelVIRGIN: initial, first (a virgin flight for the new aircraft)
Size: Large or Larger Than
ABOVE: exceeding in number, quantity, or size: more thanBIGGIE: one that is big and often important BULL: large of its kind (a bull lathe)EXPAND: to increase the extent, number, volume, or scope of: to enlarge; to increase in extent, number, volume, or scopeEXPANDED: to increase the extent, number, volume, or scope of: to enlarge; to increase in extent, number, volume, or scopeGAIN: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GAINED: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GAINING: an increase in amount, magnitude, weight, or degree; to make an increase of (a specified amount)GARGANTUAN: tremendous in size, volume, or degree: gigantic, colossal; named for Gargantua, a giant king in François Rabelais's 16th-century satiric novel GargantuaGIANT: something unusually large or powerful; also, having extremely large size, proportion, or powerGIGANTIC: exceeding the usual or expected (as in size, force, or prominence)GRAND: large and striking in size, scope, extent, or conception (a grand design)HUGE: very large or extensive; of great size or area; great in scale or degreeJACK: to raise the level or amount of (something, such as prices): to increase, to jack upMACRO: being large, thick, or exceptionally prominentMADE: to increase in height or size (the tide is making now)MAKE: to increase in height or size (the tide is making now)MAKING: to increase in height or size (the tide is making now)MAMMOTH: something immense of its kind; of very great sizeMEGA: vast (a mega electronics store)MIGHTY: great or imposing in size or extent: extraordinaryROYAL: of superior size, magnitude, or quality (a home of royal dimensions)WHALE: one that is impressive especially in size (a whale of a difference, a whale of a good time)
Size: Medium or Middling
MEDIUM: intermediate in quantity, quality, position, size, or degreeMIDDLING: of middle, medium, or moderate size, degree, or qualityNOMINAL: of, being, or relating to a designated or theoretical size that may vary from the actual: approximate (the pipe's nominal size)
Size: Small or Smaller Than
ATOMIC: minuteBABY: much smaller than the usual (e.g., baby carrots)DEFLATE: to reduce in size, importance, or effectivenessDEFLATED: to reduce in size, importance, or effectivenessDINKY: overly or unattractively smallFINE: very small (fine print)GRAIN: a minute portion or particleITTY: M-W: “We have one entry that includes the term itty: itty-bitty”LILLIPUTIAN: often not capitalized: small, miniature; derived from Lilliput, an island in Swift's Gulliver's Travels where the inhabitants are six inches tallLITTLE: not big; small in size or extent: tiny; pleasingly small (a cute little thing)MICRO: very small, especially: microscopic MINI: something small of its kind; small in relation to others of the same kindMINIM: something very minuteMINOR: inferior in importance, size, or degree: comparatively unimportantMINOR: inferior in importance, size, or degree: comparatively unimportantMINUTIA: a minute or minor detail —usually used in pluralMITE: a very small object or creatureNARROW: limited in size or scopeNARROWLY: limited in size or scopeNEGLIGIBLE: so small or unimportant or of so little consequence as to warrant little or no attention: triflingNOTHING: someone or something of no or slight value or size; the absence of all magnitude or quantityPEANUT: peanuts plural: a trifling amountPICCOLO: smaller than ordinary size (a piccolo banjo)PINCH: a very small amount (a pinch of salt)PINHEAD: something very small or insignificantPINPOINT: something that is extremely small or insignificant; also, as small as a pinpointPOCKET: small, miniature (a pocket park); also, small enough to be carried in the pocket (a pocket atlas)POKY: small and crampedPONY: something smaller than standardPUNY: slight or inferior in power, size, or importance: weakPYGMY: something very small of its kindTEENY: by alteration of tiny, very small or diminutive: minuteTINILY: in the manner or condition of something tinyTINY: tiny, very small or diminutive: minute; a variant is the Bee word TEENYTITHE: broadly: a small partTITTLE: a very small partWEENY: exceptionally small: tiny
Unequal

ABOUT THE LEXITOPICS PROJECT
Click HERE to learn more about the LexiTopics analysis project, including origins, methodology, process, and more.
Click HERE to jump to the LexiTopics main page, with links to the dozens of LexiTopics Reports.
Click HERE to see the entire LexiTopics Taxonomy, the subject list that was developed exclusively for this analysis.
Spelling Bee Words Related to QUANTITY, EXTENT, SIZE, AND DEGREE
ABATEABATEDABATEMENTABATINGABOUTABOVEACCRUALACCRUINGACCUMULATEADDEDADDENDAADDINGADDITIONADDITIONALADDITIVEADJUNCTALIKEALLAYALLAYEDALLAYINGALLOYALLOYEDALLOYINGALONGALPHAAMOUNTAMPINGAMPLIFYANTEARCHAROUNDARRANGINGARRAYATOMATOMICATTENUATEATTENUATEDATTRITIONAUGHTAUGMENTBABYBADLYBATEBATEDBATHBEANBEEFBEEFEDBELOWBETABIGGIEBIGLYBILLIONTHBLINDBONANZABOTTOMBRUNTBUILDBUILDINGBUILTBULK BULLBUMPBUMPINGCALCULATECAMECAPACITYCAPPEDCAPPINGCENTUPLECHANGECLEANCLIMBCLIPCLIPPEDCLOCKWORKCOMECOMINGCONCATENATECONTRACTCONTRACTORCONTROLCOOLCULLCULLEDCULLINGCUTBACKDAINTILYDAINTYDAMNDEADDEADLYDEALDECAYDECAYEDDECIMATEDECIMATEDDECLINEDECLINEDDEFLATEDEFLATEDDIDDLYDILATIONDINKYDIPPEDDIPPINGDOCKDOCKEDDOLLOPDOZENDRABDRIBDROPDROPPINGDWINDLEDWINDLED EASEEASESEASYECHELONELEMENTALELEMENTALLYEMINENTLYEMULATEENDEDENDINGENHANCEENHANCEDENHANCEMENTENHANCINGEQUALEQUALEDEVENEVENED EVENEREVENINGEVENLYEXACTEXPANDEXPANDEDEYEBALLEYEBALLEDFAILFAILINGFAIRLYFALLFALLENFALLINGFALLOFFFALLOFFSFALLSFELLFINALFINALLYFINEFINEDFININGFINITEFINITUDEFIVEFOLDFLAGGINGFLOODFLOODEDFLOODINGFULLYGAGEGAGGLEGAINGAINEDGAININGGAMUTGARGANTUANGAUGEGAUNTLETGENTLEGIANTGIGANTICGIRTHGOINGGONEGOODLYGRADINGGRAINGRANDGROWGROWINGGROWNHAIRHARDLYHEALTHYHEAPHEAVYHEIGHTENHEIGHTENINGHIGHHIGHLYHIKEHIKEDHIKINGHINTHOOTHUGEINAUGURALINCHINDEFINITEINEXACTINFINITEINFINITUDEINFINITYINFLATEINFLATINGINITIALIOTAITEMITTYJACKJOLLYKINDALAPIDARYLARDLEADLEEWAYLEGIONLENGTHLEVELLICKLIFETIMELIFTLIFTINGLIGHTLYLIKELILLIPUTIANLIMITLINELINEDLININGLITTLELIVELYLOADLONG
MACROMADEMADLYMAJORMAJORLYMAKEMAKINGMAMMOTHMANYMARGINMARKMAXIMAMAXIMALMEANMEDIUMMEETMEETINGMEGAMEGAHITMICROMIDDLINGMIGHTILYMIGHTYMILDMILEMILLIONMINIMINIMMINIMAMINIMALMINIMIZATIONMINIMIZEMINIMIZEDMINIMIZINGMINIMUMMINORMINORITYMINTMINTEDMINTINGMINUTIAMITEMODICUMMODIFYMONDOMORTALMOTEMOUNDMOUNTMOUNTEDMUCHMUCHOMULTILEVELMULTIMILLIONMULTIPLYMYRIADNADANARROWNARROWLYNARYNAUGHTNEATNEGLIGIBLENEXTNIBBLENIBBLINGNICENICELYNICETYNOHOWNOMINALNONENOTABLYNOTCHNOTCHEDNOTHINGNOUGHTNULLOCEANOMEGAONLYOPTIMAOUNCE OVERPALLPALLEDPALLIATIVEPALLINGPARINGPARITYPARTPARTLYPEAKPEAKEDPEAKINGPEANUTPECKPENNYPENULTPICCOLOPILEPINCHPINHEADPINKPINNACLEPINPOINTPITCHPITCHEDPITCHINGPITTANCEPLACEPLAINPLAINLYPLATPLATEAUPLATEFULPOCKETPOINTPOKYPONYPRIMARILYPRIMOPRIORPRIORITYPROPORTIONPROTRACTPROTRACTORPRUNINGPUMPPUMPEDPUMPINGPUNYPYGMYQUANTAQUITERAKINGRAMPRANGINGRANKRANKINGRATABILITYRIGHTRIOTROARINGROLLBACKROUGHROUNDINGROYALROYALLYRUNGRUNNING SEASTACTICTAILTAILINGTAKEOFFTALLTAMETAMEDTAMELYTAMINGTAMPTANGTANTAMOUNTTEEMTEEMEDTEEMINGTEENYTHICKTHICKENTHINTHINLYTHINNINGTICKTIDETIDILYTIDYTIEDTINILYTINYTITHETITTLETONNAGETOPPINGTOUCHTRACTTRAILTRAITTRILLIONTHTUMBLETUNETWICETWOFOLDTYINGUMPTEENUMPTEENTHUNBOUNDEDUNCOUNTEDUNDUEUNDULYUNEQUALUNEVENUNEVENLYUNKNOWNUPPEDUPPINGVAGUEVAGUELYVICINITYVIOLENTVIRGINWANEWANEDWANINGWEENYWELLWENTWHALEWHATWHIFFWHITWHITTLEWHOLEWHOOPWILDLYWINNOWWINNOWEDWINNOWINGWITHINWORLDWORTHYARDZOOMZOOMED
LexiConnexxions New York Times Spelling Bee answers analysis statistics peregrine
If you cite information from LexiConnexxions, please give credit and a link to the relevant page. These reports and analyses are conceived, compiled, designed, and prepared by a human being, not a machine. This website is 100% AI-free; it is conceived, designed, written, and maintained by a human being. Except where noted, all content ©2022-2026 and in perpetuity by LexiConnexxions. All rights reserved. Dissemination, re-use, or duplication by any means, for any purpose whatsoever, is prohibited except by express written permission of LexiConnexxions. This site is not affiliated with The New York Times or with any other sites related to the New York Times Spelling Bee. Contact LexiConnexxions at info // @ // lexiconnexxions.com.

We use cookies only to enable essential functionality on this website. We do not save, analyze, share, rent, or sell this information. By clicking Accept, you consent to our use of cookies. Cookies and Privacy Policy.

Your Cookie Settings

We use cookies to enable essential functionality on our website and analyze website traffic. For more information, read our Cookies and Privacy Policy below..

Cookie Categories
Essential

These cookies are strictly necessary to provide you with services available through our websites.

Analytics

These cookies collect information that is used in aggregate and in an anonymized form to help us understand how our website is being used and how effectively our site is performing.