LexiTopic: People: Individuals and Groups

If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to PEOPLE: INDIVIDUALS AND GROUPS in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Taxonomy for Spelling Bee words related to PEOPLE: INDIVIDUALS AND GROUPS
SUBJECT HEADINGS IN THIS LEXITOPIC: Ages and StagesDeath and Dying social aspects and attendant ritualsDemographics generalFamilyFoes and EnemiesFriends and Intimates not family, not groupsGender and Gender IdentityGendered Words: Female not royalty or clergyGendered Words: Male not royalty or clergyGroups and Associates social and other groups; not social behaviorHonorifics and Forms of Address not royalty, not clergy, not government, not military Individuals no particular characteristics Life, Living, Carrying OnRomance and MarriageSelf, Solitude, IsolationSexuality and Sexual BehaviorWhere We Live private homes and neighborhoods
NOTES ABOUT THE TAXONOMY FOR PEOPLE: INDIVIDUALS AND GROUPS SCOPE NOTE: This LexiTopic compiles and defines Bee words related to people as individuals and in families and groups, without regard to behavior or social setting. Words related to biological aspects of birth, life, living, death and dying are in BIOLOGY. Words that are understood to be gender-neutral (e.g., airman, actor) are not indexed as Gendered Words. Words that are epithets are also in PEOPLE: CHARACTER AND APPEARANCE. Words related to human touch other than human sexual behavior, contact, and activities are in PEOPLE: MOVEMENTS AND MOTIONS. Words related to sex work are in ENTERTAINMENT, HOSPITALITY, AND SERVICE. Words related to hotels, lodging places, etc., are in ENTERTAINMENT, HOSPITALITY, AND SERVICE. Words related to royalty, aristocracy, etc., are in HISTORY AND OLDEN TIMES. Words related to business people and their relationships are in BUSINESS AND COMMERCE. Words related to various lines of work and occupations are in OCCUPATIONS. Words related to occupations in specific fields (e.g., agriculture) are also indexed in the major LexiTopic on the relevant subject (e.g., AGRICULTURE AND FARM LIFE). Honorifics related to royalty, clergy, government, and military are in HISTORY AND OLDEN TIMES, BELIEF SYSTEMS, GOVERNMENT, CIVICS, AND POLITICS, and WEAPONS AND WARFARE.
Topical arrangement of Spelling Bee words related to PEOPLE: INDIVIDUALS AND GROUPS
Ages and Stages
ADULT: fully developed and mature; grown-up; one that is adult; especially: a human being after an age (such as 21) specified by lawAGED: grown old: of an advanced age: having attained a specified ageAGEING: or aging, to become old: show the effects or the characteristics of increasing ageAGING: or ageing, to become old: show the effects or the characteristics of increasing ageANCIENT: an aged living beingAUTUMN: a period of maturity or incipient declineAUTUMNAL: a period of maturity or incipient declineBABE: infant, babyBABIED: to tend to indulge with often excessive or inappropriate care and solicitudeBABY: an extremely young child; infantBABYPROOF: to make (something) safe for infants and young children by eliminating or minimizing potential hazardsBAMBINO*: child, babyBOYHOOD: the time, period, or condition of being a male child from birth to adulthoodCALLOW: lacking adult sophistication: immatureCAME: to approach or be near (an age) (a child coming eight years old)CHAP: Southern US and Midland US: baby, childCHICK: a childCHILD: a young person especially between infancy and puberty; also, an unborn or recently born person (pregnant with child)CHILDHOOD: the state or period of being a childCHILDLIKE: resembling, suggesting, or appropriate to a child or childhood, especially: marked by innocence, trust, and ingenuousnessCOLLEEN: an Irish girl [which is not the same as “Irish word for girl”]COME: to approach or be near (an age) (a child coming eight years old)COMING: to approach or be near (an age) (a child coming eight years old)GIRL: a female child from birth to adulthood; a young womanGIRLHOOD: of or pertaining to being a girlGIRLY: girlish; like a girlGROWNUP: M-W hyphenates grown-up: an adult; also, not childish or immature; of, for, or characteristic of adultsHEYDAY: the period of one's greatest popularity, vigor, or prosperityIMMATURITY: exhibiting less than an expected degree of maturity; lacking complete growth, differentiation, or developmentINFANT: a child in the first period of lifeINFANTILE: of or relating to infants or infancy; suitable to or characteristic of an infant; especially: very immatureINFANTILITY: of or relating to infants or infancy; suitable to or characteristic of an infant; especially: very immatureJUVENILE: a young person: a youthKIDDIE: M-W: or less commonly kiddy: a small childKIDDO: a childKIDDY: M-W: or more commonly kiddie: a small childLADDIE: a young ladLITTLE: young (was too little to remember); also a young child: a little oneMAID: an unmarried girl or woman especially when young; a virginMAJOR: of full legal age (major children); also, a person who has attained majorityMATURITY: the quality or state of being mature, especially: full developmentMILLENNIAL: a person born in the 1980s or 1990s; also, of, relating to, or belonging to the generation of people born in the 1980s or 1990s: of or relating to millennialsMINOR: not having reached majority (He is the father of minor children.); a person who is not yet old enough to have the rights of an adultMINORITY: the period before a person reaches the age of majority; also, the state of being a legal minorMOPPET: a childNEONATAL: of, relating to, or affecting the newborn and especially the human infant during the first month after birthNEONATE: a newborn child, especially: a child less than a month oldNUBILE: of marriageable condition or age (nubile young women)OLDIE: one that is oldQUAD: a quadruplet, one of four offspring produced in the same pregnancyQUINT: informal: a quintuplet, one of five offspring produced in the same pregnancyTEEN: a teenage person: a teenagerTEENAGE: of, being, relating to, or intended for teenagersTEENAGED: not in M-W; Collins has “teenaged, people are aged between thirteen and nineteen”; NOAD has teenagedTWEEN: preteen; a boy or girl not yet 13 years old; also, relating to or produced for children especially in the 9 to 12 year-old age group; also, being younger than 13; from a blend of between and teenUNFLEDGED: not fully developed: immature (an unfledged writer)UNWEANED: not accustomed to taking food otherwise than by nursing: not weaned(unweaned kittens, an unweaned foal) (the baby is yet unweaned)VIRGIN: an absolutely chaste young woman; an unmarried girl or womanVIRILITY: the quality or state of being virile: having traditionally masculine traits especially to a marked degree; characteristic of or associated with men: masculine; also, manhood, the condition of being an adult male as distinguished from a child or female; manly vigor: masculinity, the quality or nature of the male sex: the quality, state, or degree of being masculine or manlyWEAN: to accustom (a young child or animal) to take food otherwise than by nursingWEANED: to accustom (a young child or animal) to take food otherwise than by nursingWEANING: to accustom (a young child or animal) to take food otherwise than by nursingWHELP: a young boy or girlYOUNG: (plural noun) young persons: youth; also (adj) being in the first or an early stage of life, growth, or development; also, of, relating to, or having the characteristics of youth or a young person (young at heart)YOUNGLY: early in life: in youth; in a young or youthful mannerYOUTH: the time of life when one is young, especially: the period between childhood and maturity; a young person, especially: a young male between adolescence and maturity; young persons or creatures —usually plural in construction; also, the early period of existence, growth, or development; also, the quality or state of being youthful: youthfulnessYOUTHFUL: of, relating to, or characteristic of youth; being young and not yet mature; marked by or possessing youth; having the vitality or freshness of youth: vigorousYOUTHFULLY: of, relating to, or characteristic of youth; being young and not yet mature; marked by or possessing youth; having the vitality or freshness of youth: vigorousYUPPIE: often Yuppie: a young college-educated adult who is employed in a well-paying profession and who lives and works in or near a large city, probably from young urban professional + -ie [as in hippie]
Death and Dying social aspects and attendant rituals
BARROW: a large mound of earth or stones over the remains of the dead; a tumulusBODY: a dead organism: corpseBURY: to dispose of by depositing in or as if in the earth; especially: to inter with funeral ceremoniesCANOPIC: M-W has canopic jar, a jar in which the ancient Egyptians preserved the viscera of a deceased person usually for burial with the mummyCATACOMB: a subterranean cemetery of galleries with recesses for tombs —used in pluralCLAIM: to take, to put an end to by death (the accident claimed her life) COFFIN: a box or chest for burying a corpse; also, to enclose in or as if in a coffinCOFFINED: a box or chest for burying a corpse; also, to enclose in or as if in a coffinCOFFINING: a box or chest for burying a corpse; also, to enclose in or as if in a coffin COMMITTAL: consignment: the act or process of consigning: to consign a body to the graveCONK: to dieCONKED: to dieCONKING: to dieCROAK: slang: to die or to killCRYPT: a chamber in a mausoleumCURTAIN: curtains plural: end, especially: death (it will be curtains for us if we're caught)DEAD: someone who is no longer alive: one that is dead —usually used collectively (They were among the dead.); the state of being dead (raised him from the dead)DECEDENT: a person who is no longer living: a deceased personDOOM: deathDOOMED: deathDOOMING: deathEMBALM: to treat (a dead body) so as to protect from decayENTOMB: to deposit in or as if in a tomb: to bury; to serve as a tomb forENTOMBED: to deposit in or as if in a tomb: to bury; to serve as a tomb forENTOMBMENT: to deposit in or as if in a tomb: to bury; to serve as a tomb forEPITAPH: an inscription on or at a tomb or a grave in memory of the one buried there; also, a brief statement commemorating or epitomizing a deceased person or something pastFLAME: the memory, reputation, or beliefs of a deceased person; broadly: memory (keeper of the flame)GOING: present participle of to go, to die (We all have to go sometime.)GONE: past participle of to go, to die (We all have to go sometime.)IMMORTAL: exempt from death; connected with or relating to immortality; exempt from oblivion: imperishableINURN: entomb; to place in an urnINURNING: entomb; to place in an urnKEEN: a lamentation for the dead uttered in a loud wailing voice or sometimes in a wordless cryKEENED: a lamentation for the dead uttered in a loud wailing voice or sometimes in a wordless cryKEENING: a lamentation for the dead uttered in a loud wailing voice or sometimes in a wordless cryLATE: comparatively recently: now deceased —used of persons (the late John Doe); and often with reference to a specific relationship or status (his late wife)LEAVE: to bequeath, devise (left a fortune to his son); also, to have remaining after one's death (leaves a widow and two children)LEAVE: to bequeath, devise (left a fortune to his son); also, to have remaining after one's death (leaves a widow and two children)LEFT: to bequeath, devise (left a fortune to his son); also, to have remaining after one's death (leaves a widow and two children)LEGACY: something transmitted by or received from an ancestor or predecessor or from the past (legacy of the ancient philosophers, a legacy of pain and suffering; of, relating to, associated with, or carried over from an earlier time, technology, business, etc.; also, a gift by will especially of money or other personal property: a bequestLEGATE: to bequeath, to give or leave by will, used especially of personal property; to hand down: to transmitLEGATEE: one to whom a legacy is bequeathed or a devise is givenMONUMENT: a memorial stone or a building erected in remembrance of a person or eventMOUND: an artificial bank or hill of earth or stones, especially: one constructed over a burial or ceremonial siteMOUNT: a mound, an artificial bank or hill of earth or stones, especially: one constructed over a burial or ceremonial siteMOURN: to show the customary signs of grief for a death, especially: to wear mourningMOURNING: an outward sign (such as black clothes or an armband) of grief for a person's death; also, a period of time during which signs of grief are shown; also, to show the customary signs of grief for a death, especially: to wear mourningMUMMIFIED: to embalm and dry as or as if a mummy; to make into or like a mummyMUMMY: a body embalmed or treated for burial with preservatives in the manner of the ancient Egyptians; a body unusually well preservedOBIT: an obituary, a notice of a person's death usually with a short biographical accountPALL: a heavy cloth draped over a coffin; also, a coffin especially when holding a bodyPANTHEON: a building serving as the burial place of or containing memorials to the famous dead of a nationPART: to die [used idiomatically]PILE: a heap of wood for burning a corpse or a sacrificePLOT: a small piece of land in a cemetery; also, to lay out in plotsPLOTTING: a small piece of land in a cemetery; also, to lay out in plotsPOGROM: an organized massacre of helpless people, specifically: such a massacre of Jews; also, (verb) to massacre or destroy in a pogromPORTION: a share received by gift or inheritanceTOMB: an excavation in which a corpse is buried: a: grave; a place of interment; a house, chamber, or vault for the dead; a building or structure resembling a tomb (as in appearance); also, to bury, to entombVAULT: a burial chamber; also, a prefabricated container usually of metal or concrete into which a casket is placed at burialWAKE: a watch held over the body of a dead person prior to burial and sometimes accompanied by festivity; also, to stand watch over (someone or something), especially: to hold a wake overWAKING: a watch held over the body of a dead person prior to burial and sometimes accompanied by festivity; also, to stand watch over (someone or something), especially: to hold a wake overWATCH: a wake over a dead body; also, to keep vigil as a devotional exerciseWATCHED: a wake over a dead body; also, to keep vigil as a devotional exerciseWEED: dress worn as a sign of mourning (as by a widow) —usually used in plural; also, a band of crape worn on a man's hat as a sign of mourning —usually used in pluralWENT: past tense of to go, to die (We all have to go sometime.)WILL: a legal declaration of a person's wishes regarding the disposal of their property or estate after death, especially: a written instrument legally executed by which a person makes disposition of their estate to take effect after death; also, to dispose of by or as if by a will: to bequeath (willed his entire estate to his son); also, to order or direct by a will (willed that her property be divided among her children)WILLED: a legal declaration of a person's wishes regarding the disposal of their property or estate after death, especially: a written instrument legally executed by which a person makes disposition of their estate to take effect after death; also, to dispose of by or as if by a will: to bequeath (willed his entire estate to his son); also, to order or direct by a will (willed that her property be divided among her children)WILLING: a legal declaration of a person's wishes regarding the disposal of their property or estate after death, especially: a written instrument legally executed by which a person makes disposition of their estate to take effect after death; also, to dispose of by or as if by a will: to bequeath (willed his entire estate to his son); also, to order or direct by a will (willed that her property be divided among her children)WORLD: life after death —used with a qualifier (the next world)YIELD: to give up (one's breath, life, or spirit) and so dieYIELDED: to give up (one's breath, life, or spirit) and so die
Demographics general
BARBARIC: of, relating to, or characteristic of a group of people who are alien to another land, culture, or people and who are usually believed to be inferior: of, relating to, or characteristic of barbarians; also, possessing or characteristic of a cultural level more complex than primitive culture but less sophisticated than advanced civilizationBIRACIAL: of, relating to, or involving members of two; also: having parents from two racesBLACK: usually Black: of or relating to any of various population groups of especially African ancestry often considered as having dark pigmentation of the skin but in fact having a wide range of skin colors (Black Americans); also, of or relating to Black people and often especially to African American people or their culture (Black literature, a Black college); also, usually Black: a person belonging to any of various population groups of especially African ancestry often considered as having dark pigmentation of the skin but in fact having a wide range of skin colors; also, African American. Note: Capitalization of Black in this use is now widely established.BROWN: (adj.) or less commonly Brown: of or relating to any of various population groups considered as having medium pigmentation of the skin; also (noun) people belonging to any of various population groups considered as having medium pigmentation of the skin CHATTEL: an enslaved person held as the legal property of another: a bondman (slave or serf); —often used as a mass noun (he owned other human beings as chattel)COHORT: a group of individuals having a statistical factor (such as age or class membership) in common in a demographic studyDEMO: a demographic, especially, in business: a market or segment of the population identified by demographics (the product is targeted toward a younger demo)ETHNIC: of or relating to large groups of people classed according to common racial, national, tribal, religious, linguistic, or cultural origin or backgroundETHNICITY: of or relating to large groups of people classed according to common racial, national, tribal, religious, linguistic, or cultural origin or backgroundFOLK: people generally; also, a certain kind, class, or group of people (e.g., old folks)IMMIGRANT: a person who comes to a country to take up permanent residence IMMIGRATING: to enter and usually become established, especially: to come into a country of which one is not a native for permanent residenceINDIGENE: native; a member of the first people to inhabit a regionMIGRANT: an immigrant, especially: a refugee; also, someone that migrates: such as a person who moves regularly in order to find work especially in harvesting cropsMIGRATING: [of people] to move from one country, place, or locality to anotherMIXED: made up of or involving persons differing in race, national origin, religion, or class (a mixed audience, a mixed family/household); made up of or involving individuals of more than one sex (mixed company); deriving from two or more races (people of mixed race, her mixed ancestry)NATALITY: the birth rate, the ratio between births and individuals in a specified population and timePEON: any of various workers in India, Sri Lanka, or Malaysia: such as an infantryman or an orderly; also, a member of the landless laboring class in Spanish America; also, a person held in compulsory servitude to a master for the working out of an indebtedness; also, a drudge, menialPOCKET: a small often isolated area or group (pockets of unemployment)POLYGLOT: widely diverse (as in ethnic or cultural origins) (a polyglot cuisine)QUADRAT: a usually rectangular plot used for ecological or population studiesRACIAL: of, relating to, or based on a race (a racial minority), or existing or occurring between races (racial equality)RACIALLY: of, relating to, or based on a race (a racial minority), or existing or occurring between races (racial equality)RAINBOW: of, relating to, or being people of different races or cultural backgrounds (a rainbow coalition)TRIBAL: a member of an aboriginal people of India —usually used in pluralVITAL: recording data relating to lives (vital statistics)WAVE: one of a succession of influxes of people migrating into a region; also, a sudden rapid increase in a populationWHITE: a person belonging to any of various population groups considered as having light pigmentation of the skin (Note: This meaning of the noun white is usually used in the plural form and typically in contexts about population groups, as in “a policy supported by many rural whites.”); also, or less commonly White: of or relating to any of various population groups considered as having light pigmentation of the skin; also, or less commonly White: of or relating to white people or their culture (books from the canon of white literature)
Family
ADOPT: to take (a child born to other parents) voluntarily as one's own child especially in compliance with formal legal proceduresADOPTED: to take (a child born to other parents) voluntarily as one's own child especially in compliance with formal legal proceduresADOPTEE: one who is adoptedADOPTION: the act or process of adopting a childAKIN: related by bloodAUNT: the sister of one's father or mother or the wife of one's uncle or auntAUNTY: an auntBEGAT: to produce especially as an effect or outgrowthBEGET: to procreate as the father: to sireBEGETTING: to procreate as the father: to sireBEGOT: to procreate as the father: to sireBIOLOGICAL: connected by direct genetic relationship rather than by adoption or marriageBIRTH: adjective: biological (his birth mother); also, lineage, extraction (e.g., of Polish birth)BLOOD: relationship by descent from a common ancestor: kinship; persons related through common descent: kindredBRANCH: a division of a family descending from a particular ancestorBROOD: the children of a familyBUBBA: M-W’s only definition capitalizes (NOAD does not) and labels "informal, often disparaging; from Bubba, a stereotypical nickname of Southern white males. NOAD’s 1st def.: “Used as an affectionate form of address to a brother” (2d is the disparaging term)CADET: M-W 1st def: a younger brother or son, or a youngest son, or a younger branch of a family or a member of itCHILD: a son or daughter of human parents; a descendantCLAN: a group of people tracing descent from a common ancestor: familyCOGNATE: related by blood (a family cognate with another); also: related on the mother's side also, (noun) one that is cognate with anotherDADDY: father; a male parentDEPEND: to be dependent especially for financial support (Her family depends on her paycheck.)DEPENDED: to be dependent especially for financial support (Her family depends on her paycheck.)DEPENDENT: relying on another for support; also, one that is dependent, especially: a person who relies on another for supportDEPENDING: to be dependent especially for financial support (Her family depends on her paycheck.)DINK: often all capitalized: a couple with two incomes and no children; or a member of such a couple (double income, no kids)ENATE*: one related on the mother’s sideFAMILIAL: tending to occur in more members of a family than expected by chance alone; of, relating to, or suggestive of a familyFAMILIARLY: of or relating to a familyFAMILY: the basic unit in societyFILIAL: of, relating to, or befitting a son or daughter; or having or assuming the relation of a child or offspringFILIALLY: of, relating to, or befitting a son or daughter; or having or assuming the relation of a child or offspringFLEDGE: to rear until ready for flight or independent activityFLEDGED: to rear until ready for flight or independent activityFLEDGING: to rear until ready for flight or independent activityFOLK: the persons of one's own family, especially parentsFRUIT: offspring, progenyFULL: having both parents in common (full sisters)GENEALOGY: an account of the descent of a person, family, or group from an ancestor or from older forms; or the study of family ancestral lines; of an account of the origin and historical development of somethingGIRL: daughterGRAM: grandmotherGRAMMA: M-W does not have an entry for this word for grandmotherGRAMP: grandfatherGRAMPA: M-W does not have an entry for this word for grandfatherGRAN: grandmotherGRANDAD: or granddad: grandfatherGRANDADDY: grandfatherGRANDBABY: grandchildGRANDDAD: or grandad: grandfatherGRANDDADDY: grandfatherGRANDPA: grandfatherGRANDPAPA: grandfatherGRANDPOP: grandfatherGRANNY: grandmotherGUARDIAN: someone who has the care of the person or property of another; often, specifically: a person granted legal custody of a minor who is not the person's own biological childHOME: the social unit formed by a family living together; also, one’s place of originHUBBY: husbandINDEPENDENCE: the quality or state of being independent: not requiring or relying on others (as for care or livelihood) (independent of her parents)INDEPENDENT: not requiring or relying on others (as for care or livelihood) (independent of her parents)KITH: familiar friends, neighbors, or relativesLEGACY: a candidate for membership in an organization (such as a school or fraternal order) who is given special status because of a familial relationship to a memberLEGITIMIZE: to make legitimate: to legitimate, to make legitimate: to give (a child born out of wedlock) the same legal status as a child born in wedlockLINE: family, lineage (descended from a noble line)LINEAGE: descent in a line from a common progenitor; also, a group of individuals tracing descent from a common ancestor, especially: such a group of persons whose common ancestor is regarded as its founderLINEAL: consisting of or being in a direct male or female line of ancestry; relating to or derived from ancestors: hereditary; descended in a direct line; belonging to one lineage (lineal relatives); of, relating to, or dealing with a lineageLINEALLY: consisting of or being in a direct male or female line of ancestry; relating to or derived from ancestors: hereditary; descended in a direct line; belonging to one lineage (lineal relatives); of, relating to, or dealing with a lineageLODGE: a family of North American Indians (The tribe consisted of about 200 lodges.)LORD: a husbandMADAM: a woman who is the head of a household: a wifeMAINTAIN: to support or provide for; to sustain (has a family to maintain) (enough food to maintain life)MAINTAINING: to support or provide for; to sustain (has a family to maintain) (enough food to maintain life)MAMA: less commonly mamma or momma, or variant mommy: mother; also, slang: wife, womanMAMMA: less common spelling of mama: mother; also, slang: wife, womanMAMMY*: mamaMATRIARCH: a woman who rules or dominates a family, group, or state; specifically: a mother who is head and ruler of her family and descendantsMATRON: a married woman usually marked by dignified maturity or social distinctionMENAGE*: M-W has ménage, a domestic establishment: a householdMOMMA: less common spelling of mama: mother; also, slang: wife, womanMOMMY: variant of momma: a female parent; a motherNAME: family, clan (was a disgrace to his name)NANA: the mother of one's father or mother: grandmother —often used as a form of address (Nana Jones)NANNIED: Not in M-W. Collins has (verb): to nurse or look after someone else's childrenNANNY: M-W has only (noun): a child's nurse or caregiver; Collins has (verb): to nurse or look after someone else's childrenNANNYING: Not in M-W. Collins has (noun): the activity of nursing or looking after someone else's children NATURAL: connected by direct genetic relationship rather than by adoption or marriage: biological (their natural son, her natural parents); born to parents not married to each other (a natural child)NEPHEW: a son of one's brother, sister, brother-in-law, or sister-in-lawNIECE: a daughter of one's brother, sister, brother-in-law, or sister-in-lawONCE: by one degree of relationship (first cousin once removed)ONLY: having no brother or sister (an only child)ORIGIN: ancestry, parentageORPHAN: a child deprived by death of one or usually both parents; also, to cause to become an orphanORPHANHOOD: the state of being an orphanPAPA: father [French: baby talk]PAPPY: chiefly Southern US and Midland US: papa, fatherPEOPLE: the members of a family or kinshipPOPPA: less common spelling of papaROOT: roots plural: one or more progenitors of a group of descendantsTHROUGH: by common descent from or relationship with (related through their grandfather)THROWAWAY: a child who has been forced to leave home or who has run away from indifferent or hostile parentsTOTEM: an object (such as an animal or plant) serving as the emblem of a family or clan and often as a reminder of its ancestry; also: a usually carved or painted representation of such an object; also, a family or clan identified by a common totemic object; also, one that serves as an emblem or revered symbolTUTELAGE: a guiding influence; also, the state of being under a guardian or tutor; also, an act or process of serving as guardian or protector: guardianship (protection, care, specifically: the relationship existing between guardian and ward)TUTOR: a person charged with the guidance of another; also, to have the guardianship, tutelage, or care of; to do the work of a tutorTWIN: either of two offspring produced in the same pregnancy; also, (adj) born with one other or as a pair at one birth (my twin brother, twin girls); also, to bring forth twinsTWINNING: either of two offspring produced in the same pregnancy; also, (adj) born with one other or as a pair at one birth (my twin brother, twin girls); also, to bring forth twinsUNCLE: the brother of one's father or mother; also, the husband of one's aunt or uncleUPBRINGING: early training, especially: a particular way of bringing up a child (had a strict upbringing)VENDETTA: a blood feud, a feud between different clans or familiesWHOLE: having the same father and mother (whole brother)YOUNG: junior: less advanced in age: younger —used chiefly to distinguish a son with the same given name as his father (young Bob)
Foes and Enemies
ANATHEMA: someone or something intensely disliked or loathedARCHRIVAL: a principal rivalCOLLABORATOR: someone who assists an enemy (such as an invader or part of an occupying force) ENEMY: one that is antagonistic to another, especially: one seeking to injure, overthrow, or confound an opponentENMITY: positive, active, and typically mutual hatred or ill willMORTAL: marked by unrelenting hostility (a mortal enemy)OUTED: to put out: to eject (someone) from a place, office, or possession: to expelOUTING: to put out: to eject (someone) from a place, office, or possession: to expel
Friends and Intimates not family, not groups
ACCOMPANY: to go with as an associate or companionACQUAINT: to cause to know personallyALONG: in company: as a companion (brought her along; along with friends)AMITY: friendship, especially: friendly relations between nationsATTACH: to bind by personal ties (as of affection or sympathy) (e.g., was strongly attached to his family)ATTACHMENT: the state of being personally attached: fidelity; affectionate regardBEDFELLOW: one who shares a bed with another; a person or thing closely associated with another: an allyBIRD: a fellow; a comrade or associateBOND: a uniting or binding element or force: a tie (the bonds of friendship); also, to form a close relationship especially through frequent association (the new mother bonded with her child)BONDING: a uniting or binding element or force: a tie (the bonds of friendship); also, to form a close relationship especially through frequent association (the new mother bonded with her child)BUDDY: a companion, partner, or friendCHUM: a close friend; palCLICK: to fit together: to hit it off (they did not click as friends)CLICKED: to fit together: to hit it off (they did not click as friends)CLICKING: to fit together: to hit it off (they did not click as friends)CLING: to have a strong emotional attachment or dependence (he clung to his friends)CLINGING: to have a strong emotional attachment or dependence (he clung to his friends)CLUNG: past tense and past participle of cling, to have a strong emotional attachment or dependence (he clung to his friends)COMPANION: one that accompanies another: a comrade, associate (a traveling companion); also: one that keeps company with another (his longtime companion); also, to accompany, to keep companyCONCORD: a state of agreement: harmonyCONCORDANT: in agreementCRONY: a close friend especially of long standingDANGLE: to be a hanger-on or a dependentDANGLED: to be a hanger-on or a dependentDANGLING: to be a hanger-on or a dependentDYAD: sociology: two individuals (such as husband and wife) maintaining a sociologically significant relationshipFAMILIAR: one who is often seen and well known, especially: an intimate associate : companionFAMILIARLY: closely acquainted: intimateFELLOW: comrade, associate; an equal in rank, power, or character: peerGIRL: US, informal: a female friendHENCHMAN: a trusted follower: a right-hand manHENCHMEN: a trusted follower: a right-hand manHOBNOB: to associate familiarlyHOBNOBBY*: M-W does not have an entry for hobnobby; Collins has hobnobby, in British English, adj, informal, tending to hobnob or characterized by hobnobbingHOMEY: a homeboy, slang: a boy or man from one's neighborhood, hometown, or regionINTIMACY: the state of being intimate: familiarity; also, something of a personal or private natureINTIMATE: (adj.) marked by a warm friendship developing through long association; also, (noun) a very close friend or confidant: an intimate friendKITH: familiar friends, neighbors, or relatives LOVER: an affectionate or benevolent friendMATE: an associate, companionMATEY: M-W’s only definition: chiefly British: companionableMUTUAL: directed by each toward the other or the others; having the same feelings one for the other; characterized by intimacyPALLED: to be or become pals: to associate as pals (they've palled around for years)PALLING: to be or become pals: to associate as pals (they've palled around for years)THICK: associated on close terms: intimate (was quite thick with his friends)TIGHT: having a close personal or working relationship: intimate (is tight with the boss, tight with her cousins)TIGHTLY: having a close personal or working relationship: intimate (is tight with the boss, tight with her cousins)WALK: to be or act in association: to continue in union (walk together side by side)WELL: in a familiar manner (knew her well)WINGMAN: informal: a male friend or partner who accompanies and supports a man in some activityWINGMEN: informal: a male friend or partner who accompanies and supports a man in some activity
Gender and Gender Identity
ANIMA: an inner feminine part of the male personalityBUTCH: notably or deliberately masculine in appearance or mannerDRAG: (noun) entertainment in which performers caricature or challenge gender stereotypes (as by dressing in clothing that is stereotypical of another gender, by using exaggeratedly gendered mannerisms, or by combining elements of stereotypically male and female dress) and often wear elaborate or outrageous costumes; also, the costumes worn by drag performers (performing in drag); also: stereotypically gendered clothing worn by someone who is of a different gender; also, (adj.) of, being, involving, or intended for a person wearing clothing typical of the opposite sex: of, being, involving, or intended for a person in drag (a drag ball)ENBY: M-W does not have an entry for enby, the spelled-out initialism NB for nonbinary, a person whose gender identity is not strictly male or female; one who is outside of the gender binaryEUNUCH: a castrated man placed in charge of a harem or employed as a chamberlain in a palace; or a man or boy deprived of the testes or external genitals FEMALE: having a gender identity that is the opposite of maleFEMININE: of, relating to, or being a woman or girlFEMININITY: of, relating to, or being a woman or girlFEMME: a woman, or a lesbian who is notably or stereotypically feminine in appearance and mannerGAYDAR: slang: the supposed ability to recognize through observation or intuition that a person is gay; blend of gay + radarGIRL: a person whose gender identity is femaleMALE: a male person: a man or a boy; an individual of the sex that is typically capable of producing small, usually motile gametes (such as sperm or spermatozoa) which fertilize the eggs of a female; of, relating to, or being the sex that typically has the capacity to produce relatively small, usually motile gametes which fertilize the eggs of a femaleMANHOOD: qualities associated with men: manliness; the condition of being an adult male as distinguished from a child or female; adult males: menMANLY: having qualities traditionally associated with a man: strong, virile; appropriate in character to a man; in a manly mannerOUTED: to identify (someone) publicly as being such secretly; especially: to reveal the covert sexual orientation or gender identity of (someone)OUTING: the public disclosure of the covert sexual orientation or gender identity of a prominent personQUEEN: slang, often disparaging: a gay man, especially: an effeminate one; also, a drag queenTOMBOY: a girl who behaves in a manner usually considered boyishUNMAN: to deprive of manly vigor, fortitude, or spirit; to castrate, emasculateUNMANLY: not manly: such as being of weak character: cowardly; or having qualities considered more typical of a womanUNMANNING: to deprive of manly vigor, fortitude, or spirit; to castrate, emasculateWOMAN: distinctively feminine nature: womanliness; also, an adult female person; also, womankind: female human beings: women especially as distinguished from men; also, a woman who is extremely fond of or devoted to something specified (I'm a chocolate woman through and through); also, a woman belonging to a particular category (as by birth, residence, membership, or occupation) —usually used in combination (a councilwoman)WOMANHOOD: the state of being a woman; the distinguishing character or qualities of a woman or of womankind; also, women, womankindWOMANLY: having qualities traditionally associated with women; also, appropriate in character to a womanWOMEN: plural of woman, distinctively feminine nature: womanliness; also, an adult female person; also, womankind: female human beings: women especially as distinguished from men; also, a woman who is extremely fond of or devoted to something specified (I'm a chocolate woman through and through); also, a woman belonging to a particular category (as by birth, residence, membership, or occupation) —usually used in combination (a councilwoman)
Gendered Words: Female not royalty or clergy
ADWOMEN: a person who writes, solicits, or places advertisementsALUMNA: a girl or woman who is a former member, employee, contributor, or inmate (an alumna of a TV series) ALUMNAE: plural of alumna, a girl or woman who is a former member, employee, contributor, or inmate (an alumna of a TV series)AMAZON: M-W often capitalized: a tall strong often masculine woman, named for the race of female warriors of Greek mythologyAUNT: the sister of one's father or mother or the wife of one's uncle or auntAUNTY: an auntBABE: slang: girl, woman; slang: a person and especially a young woman who is sexually attractiveBAGGAGE: dated: a contemptible or disreputable womanBARMAID: a woman who serves liquor at a barBATTLEAX: M-W hyphenates battle-ax or battle-axe: a usually older woman who is sharp-tongued, domineering, or combativeBATTLEAXE: M-W hyphenates battle-ax or battle-axe: a usually older woman who is sharp-tongued, domineering, or combativeBAWD: one who keeps a house of prostitution: a madam; also, a prostituteBELLE: a popular and attractive girl or womanBIDDY: a hired girl or cleaning woman; also, usually disparaging: a woman, especially: an elderly woman; diminutive of the name Bridget [probably an Irish servant]BITCH*: informal + often offensive: a malicious, spiteful, or overbearing woman; used as a generalized term of abuse and disparagement for a womanBLONDE: a person having blond hair —spelled blond when used of a boy or man and usually blonde when used of a girl or womanBLUE: a bluestocking, a woman having intellectual or literary interestsBROAD: slang, often offensive: a womanBUNNY: dated, informal: an attractive young womanCHICK: informal + sometimes offensive: girl, womanCHICKEN: a young womanCHIT: archaic: a child; also, a pert young womanCHOIRGIRL: M-W does not include choirgirl, a girl member of a choirCOED: short for coeducational student: somewhat old-fashioned: a female student in a coeducational institutionCOLLEEN: an Irish girl [which is not the same as “Irish word for girl”]COWGIRL: girl or woman who tends cattle or horses; or a girl or woman who is a rodeo performerCUTEY: M-W: variant of cutie, an attractive person, especially: a pretty girlCUTIE: M-W: or cutey; an attractive person, especially: a pretty girlCZARINA: the wife of a czar, the ruler of Russia until the 1917 revolutionDAIRYMAID: a woman employed in a dairyDAME: informal: an elderly woman: matron; US slang, old-fashioned: woman; also, a female member of an order of knighthood —used as a title prefixed to the given nameDEMIMONDE: a class of women on the fringes of respectable society supported by wealthy lovers; also, their worldDITZ: a ditzy person; one who is eccentrically silly, giddy, or inane: dizzy. [Neither M-W or Collins mentions the gendered aspect of this epithet, but NOAD says for ditzy “silly or scatterbrained (typically used of a woman)” and etymonline says “stupid, scatterbrained (especially of women).”]DIVA: a prima donna: a vain or undisciplined person who finds it difficult to work under direction or as part of a team; also, a usually glamorous and successful female performer or personalityDOLL: a pretty but often empty-headed young woman; a woman; darling, sweetheart; an attractive person, probably from Doll, nickname for DorothyDOVE: a gentle woman or childDOWDY: noun: a dowdy womanDOYENNE: a woman who is a doyen, the senior member of a body or groupDRAB: a slattern: disapproving, a woman who has multiple sexual partners: a woman who is sexually promiscuous; also, a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerFEMALE: a female person: a woman or a girl; made up of usually adult members of the female sex: consisting of females; characteristic of girls, women, or the female sex: exhibiting femaleness; designed for or typically used by girls or women; engaged in or exercised by girls or women; having a quality (such as small size or delicacy of sound) sometimes associated with the female sexFEMININE: poetry: being an unstressed and usually additional final syllable after the final complete foot in a line of verse; also, of rhyme: having an unstressed final syllableFEMININITY: of, relating to, or being a woman or girlFEMME: a woman, or a lesbian who is notably or stereotypically feminine in appearance and mannerFILLY: a young woman: a girlGAMINE: a girl who hangs around on the streets, or a small playfully mischievous girlGILL: a girl, sweetheart [soft g] Middle English, from Gill, nickname for GillianGIRL: a female child from birth to adulthood; a young woman; also, sometimes offensive: a single or married woman of any age; daughter; US, informal a female friend; a person whose gender identity is female; a female romantic partner: a girlfriendGIRLHOOD: of or pertaining to being a girlGIRLY: girlish; like a girlGORGON: an ugly or repulsive woman, named for Gorgon (capitalized), any of three snake-haired sisters in Greek mythology whose appearance turns the beholder to stoneGRAM: grandmotherGRAMMA: M-W does not have an entry for this word for grandmotherGRAN: grandmotherGRANNY: grandmotherHARPY: a shrewish woman, from Latin Harpyia, from Greek, a foul malign creature in Greek mythology that is part woman and part bird [the creature is always capitalized]HARRIDAN: a shrew, an ill-tempered scolding woman HELLCAT: a witch: a mean or ugly old woman: a hag, crone; also, a violently temperamental person; especially: an ill-tempered womanHEPTATHLETE: an athlete who competes in a heptathlon, a composite contest for female athletes that consists of the 100-meter hurdles, the high jump, the shot put, the 200-meter dash, the long jump, the javelin throw, and the 800-meter runHONEY: an attractive womanINGENUE: a naive girl or young womanJADE: a disreputable woman or a flirtatious girlLADY: a woman, a female —often used in a courteous reference (show the lady to a seat; ladies and gentlemen); also, a woman of superior social position; a woman of refinement and gentle manners; also, a wife, girlfriend, mistressLANDLADY: a woman who is a landlord [LOL]LAYWOMAN: a woman who is a member of the laityLOVELY: a beautiful womanMADAM: a woman who runs a brothel; also, mistress —used as a title formerly with the given name but now with the surname or especially with a designation of rank or office (Madam Chairman, Madam President); also, a woman who is the head of a household: a wife; also, a woman who runs a brothel; also, lady —used without a name as a form of respectful or polite address to a woman (Right this way, madam.); also, Madam —used as a conventional form of address in the salutation of a letter; also, used as a title formerly with the given name but now with the surname or especially with a designation of rank or office (Madam Chairman, Madam President)MADAME: also madam, used as a title equivalent to Mrs. for a married woman not of English-speaking nationality; also, a woman who runs a brothelMAID: an unmarried girl or woman especially when young; a virgin; also, a maidservant; a woman or girl employed to do domestic workMAMA: less commonly mamma or momma, or variant mommy: mother; also, slang: wife, womanMAMMA: less common spelling of mama: mother; also, slang: wife, womanMAMMY*: mama; also, offensive: a Black woman serving as a nurse to white children especially formerly in the southern U.S.MINX: a pert girl or a wanton womanMOLL: a darling, sweetheart; also, a gangster's girlfriend; probably from Moll, nickname for MaryMOMMA: less common spelling of mama: mother; also, slang: wife, womanMOMMY: variant of momma: a female parent; a motherPEAT: dated, disparaging: a bold lively womanPIXIE: a usually petite vivacious woman or girlQUEEN: a woman eminent in rank, power, or attractions (the pop music queen); also, an attractive girl or woman, especially: a beauty contest winnerROMP: one that romps, especially: a romping girl or womanTART: informal + disapproving: a woman who has multiple sexual partners: a woman who is sexually promiscuous; also, a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerTOMBOY: a girl who behaves in a manner usually considered boyishTRAMP: disparaging: a woman who has multiple sexual partners: a woman who is sexually promiscuous; also, disparaging: a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerTRICK: an attractive child or woman (a cute little trick)TROLLOP: a vulgar or disreputable woman, especially: one who engages in sex promiscuously or for moneyTROT: an old womanTRULL*: old-fashioned + usually disparaging: a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerVAMP: a woman who uses her charm or wiles to seduce and exploit men; short for vampire, one who lives by preying on others, especially a woman who exploits and ruins her lover; also, to practice seductive wiles on; to act like a vamp (vamping for the camera)VIRGIN: an absolutely chaste young woman; an unmarried girl or womanWAHINE: a Polynesian woman, also, a female surferWAIF: an extremely thin and usually young womanWENCH: old-fashioned: a young woman or girl; also, old-fashioned: a female servant (a tavern wench)WIDOW: a woman who has lost her spouse or partner by death and usually has not remarried; also, a grass widow, woman whose husband is temporarily away from her, or a woman divorced or separated from her husband; also, a woman whose spouse or partner leaves her alone or ignores her frequently or for long periods to engage in a usually specified activity (a golf widow, a video game widow); also, to cause to become a widow or widowerWIDOWED: a woman who has lost her spouse or partner by death and usually has not remarried; also, a grass widow, woman whose husband is temporarily away from her, or a woman divorced or separated from her husband; also, a woman whose spouse or partner leaves her alone or ignores her frequently or for long periods to engage in a usually specified activity (a golf widow, a video game widow); also, to cause to become a widow or widowerWITCH: a mean or ugly old woman: a hag, crone; also, a charming or alluring girl or womanWOMAN: an adult female person; also, womankind: female human beings: women especially as distinguished from men; also, a woman who is extremely fond of or devoted to something specified (I'm a chocolate woman through and through); also, a woman belonging to a particular category (as by birth, residence, membership, or occupation) —usually used in combination (a councilwoman)WOMANHOOD: the state of being a woman; the distinguishing character or qualities of a woman or of womankind; also, women, womankindWOMANLY: having qualities traditionally associated with women; also, appropriate in character to a womanWOMEN: plural of woman, an adult female person; also, womankind: female human beings: women especially as distinguished from men; also, a plural of woman, woman who is extremely fond of or devoted to something specified (I'm a chocolate woman through and through); also, a woman belonging to a particular category (as by birth, residence, membership, or occupation) —usually used in combination (a councilwoman)WORKWOMAN: a woman who worksYENTA: M-W has only yenta, Collins has “or yente,” one that meddles. From Yente Telebende, the character of a gossiping, henpecking wife in a 1920s-1930s comic series.YENTE: M-W has only yenta, Collins has “or yente,” one that meddles. From Yente Telebende, the character of a gossiping, henpecking wife in a 1920s-1930s comic series.
Gendered Words: Male not royalty or clergy
ADMAN: a person who writes, solicits, or places advertisementsALUMNI: plural of alumnus, a person who has attended or has graduated from a particular school, college, or university, or a person who is a former member, employee, contributor, or inmate; —usually used of a man in the singular but often of men and women in the pluralANCHORMAN: a broadcaster (as on a news program) who introduces reports by other broadcasters and usually reads the newsAPEMAN: M-W hyphenates ape-men, a primate (such as an australopithecine) intermediate in character between Homo sapiens and the higher apesAPEMEN: M-W hyphenates ape-men, a primate (such as an australopithecine) intermediate in character between Homo sapiens and the higher apesAXMAN: one who wields an ax; also, slang: a guitarist especially in a jazz or rock bandBAGMAN: a person who on behalf of another collects or distributes illicitly gained money. Broadly: an intermediary in an illicit or unethical transactionBAGMEN: a person who on behalf of another collects or distributes illicitly gained money. Broadly: an intermediary in an illicit or unethical transactionBALLBOY: M-W shows as open compound: ball boy: a male attendant who retrieves balls for players or officials (as in a tennis match or a baseball or basketball game)BAMBINO*: child, babyBARMAN: a bartenderBATBOY: a boy employed to look after the equipment (such as bats) of a baseball teamBEAU: a boyfriend; also, a dandy; a man who gives exaggerated attention to personal appearanceBELLBOY: a bellhop: a hotel or club employee who escorts guests to rooms, assists them with luggage, and runs errandsBELLMAN: a bellhop: a hotel or club employee who escorts guests to rooms, assists them with luggage, and runs errandsBELLMEN: a bellhop: a hotel or club employee who escorts guests to rooms, assists them with luggage, and runs errandsBLOKE: M-W’s only def.: chiefly British, informal: man, fellowBLOND: a person having blond hair —spelled blond when used of a boy or man and usually blonde when used of a girl or womanBLOOD: a man who dresses showily and behaves in an immoral or improper way: a rakeBOATMAN: a man who works on, deals in, or operates boatsBOWMEN: an archer, a person who uses a bow and arrow, or an archery competitor; also, a boatman, oarsman, or paddler in the front of a boatBOYHOOD: the time, period, or condition of being a male child from birth to adulthoodBUBBA: M-W’s only definition capitalizes (NOAD does not) and labels "informal, often disparaging; from Bubba, a stereotypical nickname of Southern white males. NOAD’s 1st def.: “Used as an affectionate form of address to a brother” (2d is the disparaging term)BUCK: a male human being: a man; a dashing fellow: a dandyBUDDY: a companion, partner, or friendCADET: M-W 1st def: a younger brother or son, or a youngest son, or a younger branch of a family or a member of itCHAIRMAN: a person and especially a man who serves as chairperson; also, to preside as chairperson of (chaired a commission)CHARRO*: a Mexican horseman or cowboy typically dressed in an elaborately decorated outfitCHICKEN: slang: a young or youthful gay man; also: a boy or young man regarded as an object of sexual interest especially by a manCHOIRBOY: a boy member of a choir; also, an innocent or virtuous man: altar boyCOACHMAN: a man who drives a coach or carriageCOWHAND: a cowboyCZAR: an emperor, specifically: the ruler of Russia until the 1917 revolutionDADDY: father; a male parent; also, granddaddy, one that is the first, earliest, or most venerable of its kind (the daddy of old sycamores in that region)DANDY: a man who gives exaggerated attention to personal appearance; probably short for jack-a-dandyDOORMAN: a usually uniformed attendant at the door of a building (such as a hotel or apartment building)DOYEN: the senior member of a body or groupDUDE: a man extremely fastidious in dress and manner: dandyEUNUCH: a castrated man placed in charge of a harem or employed as a chamberlain in a palace; or a man or boy deprived of the testes or external genitals FELLA: a fellow, a man or boyFELLOW: man, boy; also a boyfriend or beauFOOTMAN*: a servant in livery formerly attending a rider or required to run in front of his master's carriage; or a servant who serves at table, tends the door, and runs errands; also, a traveler on foot: pedestrian; also, an infantrymanGAGMAN*: a gag writer; a comedianGAGMEN*: a gag writer; a comedianGALLANT: a young man of fashion; also, a ladies' man; a suitor; a paramour (an illicit or secret lover)GAMIN: a boy who hangs around on the streets: an urchinGENT: short for gentlemanGENTLEMAN: a man who combines gentle birth or rank with chivalrous qualities, or whose conduct conforms to a high standard of propriety or correct behavior; or a man of independent means who does not engage in any occupation or profession for gain, or who does not engage in a menial occupation or in manual labor for gainGENTLEMEN: a man who combines gentle birth or rank with chivalrous qualities, or whose conduct conforms to a high standard of propriety or correct behavior; or a man of independent means who does not engage in any occupation or profession for gain, or who does not engage in a menial occupation or in manual labor for gainGIGOLO: a man who is paid to be a sexual partner and companion; also, a male sex worker hired to attend a social engagement with someone: a man who is an escort; also, dated: a man who is paid to be a dancing partnerGOAT: a licentious man: lecherGOON: a man hired to terrorize or eliminate opponentsGRAMP: grandfatherGRAMPA: M-W does not have an entry for this word for grandfatherGRANDAD: or granddad: grandfatherGRANDADDY: grandfatherGRANDDAD: or grandad: grandfatherGRANDDADDY: grandfatherGRANDPA: grandfatherGRANDPAPA: grandfatherGRANDPOP: grandfatherGROOM: a bridegroomGUNMAN: a man armed with a gun, especially: a professional killerGUNMEN: a man armed with a gun, especially: a professional killerHANGMAN: one who hangs a condemned person; also: a public executionerHEAD: a headmaster, a man heading the staff of a private school: a principalHENCHMAN: a member of a gang; a trusted follower: a right-hand man; a political follower whose support is chiefly for personal advantageHENCHMEN: a member of a gang; a trusted follower: a right-hand man; a political follower whose support is chiefly for personal advantageHITMEN: M-W has the open compound hit man, a professional assassin who works for a crime syndicate; a hatchet manHUBBY: husbandHUNK: an attractive and usually well-built manICEMAN: one who sells or delivers ice; also, a man skilled in traveling on iceICEMEN: one who sells or delivers ice; also, a man skilled in traveling on iceIRONMAN: M-W has iron man, a man of unusual physical endurance; Collins has ironman; NOAD has iron manJACK: a man, usually used as an intensive in such phrases as “every man jack”JAYBIRD: a dandy, a man who gives exaggerated attention to personal appearanceLADDIE: a young ladLANDLORD: the owner of property (such as land, houses, or apartments) that is leased or rented to another; the master of an inn or lodging house: innkeeperLAYMAN: person who does not belong to a particular profession or who is not expert in some field, or a person who is not a member of the clergyLAYMEN: person who does not belong to a particular profession or who is not expert in some field, or a person who is not a member of the clergyLECH: [by shortening] a lecher, a man who engages in lechery, inordinate indulgence in sexual activity: lasciviousnessLETCH*: [by shortening & alteration]: a lecher, a man who engages in lechery, inordinate indulgence in sexual activity: lasciviousnessMAILMAN: a man who delivers mailMAILMEN: a man who delivers mailMALE: having a gender identity that is the opposite of female; made up of usually adult members of the male sex: consisting of males (a male choir); characteristic of boys, men, or the male sex: exhibiting maleness (a deep male voice); designed for or typically used by boys or men (a male contraceptive); engaged in or exercised by boys or men (male sports); having a quality (such as vigor or boldness) sometimes associated with the male sexMANHOOD: the condition of being a human being; also, qualities associated with men: manliness; the condition of being an adult male as distinguished from a child or female; adult males: menMANLY: having qualities traditionally associated with a man: strong, virile; appropriate in character to a man; in a manly mannerMENFOLK: men in general; also, the men of a family or communityPLAYBOY: a man who lives a life devoted chiefly to the pursuit of pleasurePRICK: slang, vulgar: a spiteful or contemptible man often having some authorityPUNK: a young inexperienced person: beginner, novice; especially: a young man; also, slang: a young man used as a sexual partner by another man especially in a prisonQUEEN: slang, often disparaging: a gay man, especially: an effeminate one; also, a drag queenUNCLE: the brother of one's father or mother; also, the husband of one's aunt or uncleUNMAN: to deprive of manly vigor, fortitude, or spirit; to castrate, emasculateUNMANLY: not manly: such as being of weak character: cowardly; or having qualities considered more typical of a womanUNMANNING: to deprive of manly vigor, fortitude, or spirit; to castrate, emasculateVIRILITY: the quality or state of being virile: having traditionally masculine traits especially to a marked degree; characteristic of or associated with men: masculine; also, manhood, the condition of being an adult male as distinguished from a child or female; manly vigor: masculinity, the quality or nature of the male sex: the quality, state, or degree of being masculine or manlyWINGMAN: a pilot who flies behind and outside the leader of a flying formation; also, informal: a male friend or partner who accompanies and supports a man in some activity; also, a winger, a player (as in soccer or ice hockey) in a wing positionWINGMEN: a pilot who flies behind and outside the leader of a flying formation; also, informal: a male friend or partner who accompanies and supports a man in some activity; also, a winger, a player (as in soccer or ice hockey) in a wing positionWOLF: a man [who is] forward, direct, and zealous in amatory attentions to womenWORKMAN: a workingman, one who works for wages usually at manual labor; also, an artisan, a worker who practices a trade or handicraft: a craftspersonYOUTH: a young person, especially: a young male between adolescence and maturity
Groups and Associates social and other groups; not social behavior
ABOARD: in or into a group, association, or organizationAFFILIATE: an affiliated person or organization (her social affiliates; the network's local affiliates); also, to connect or associate oneself: to combine, to bring into such close relationship as to obscure individual characters: to merge; to bring or receive into close connection as a member or branch (The medical school is affiliated with a hospital.); to associate as a member (affiliates herself with the local club)AFFILIATING: an affiliated person or organization (her social affiliates; the network's local affiliates); also, to connect or associate oneself: to combine, to bring into such close relationship as to obscure individual characters: to merge; to bring or receive into close connection as a member or branch (The medical school is affiliated with a hospital.); to associate as a member (affiliates herself with the local club)AFFINITY: sympathy marked by community of interest: kinship; likeness based on relationship or causal connectionALLEGIANCE: devotion or loyalty to a person, group, or causeALLIANCE: a bond or connection between families, states, parties, or individualsALLIED: to unite or form a connection or relation between: to associate; also, one that is associated with another as a helper: a person or group that provides assistance and support in an ongoing effort, activity, or struggleALLY: to unite or form a connection or relation between: to associate; also, one that is associated with another as a helper: a person or group that provides assistance and support in an ongoing effort, activity, or struggleALLYING: to unite or form a connection or relation between: to associate; also, one that is associated with another as a helper: a person or group that provides assistance and support in an ongoing effort, activity, or struggleALUMNA: a girl or woman who is a former member, employee, contributor, or inmate (an alumna of a TV series) ALUMNAE: plural of alumna, a girl or woman who is a former member, employee, contributor, or inmate (an alumna of a TV series)ALUMNI: plural of alumnus, a person who is a former member, employee, contributor, or inmate; —usually used of a man in the singular but often of men and women in the pluralAMONG: in company or association with (e.g., among artists)ARMY: a body of persons organized to advance a causeATTACH: to bring (oneself) into an association (e.g., attached herself to their cause)ATTEND: to be present with: accompanyATTENDED: to be present with: accompanyBLOC: a combination of persons, groups, or nations forming a unit with a common interest or purpose (a bloc of voters)BLOCK: a bloc, a combination of persons, groups, or nations forming a unit with a common interest or purpose (popular among several voting blocks)BLOCKS: a bloc, a combination of persons, groups, or nations forming a unit with a common interest or purpose (popular among several voting blocks)BLOCS: a combination of persons, groups, or nations forming a unit with a common interest or purpose (a bloc of voters)BODY: a group of persons or things or a group of individuals organized for some purposeBOLT: to break away from or oppose one's previous affiliation (as with a political party or sports team)BUBBLE: an enclosed or isolated sphere of experience or activity in which the like-minded members of a homogeneous community support and reinforce their shared opinions; also, a usually small group of people (such as family members, friends, coworkers, or classmates) who regularly interact closely with one another but with few or no others in order to minimize exposure and reduce the transmission of infection during an outbreak of a contagious diseaseCARRY: to have or maintain on a list or record (carry a person on a team)CARRYING: to have or maintain on a list or record (carry a person on a team)CATCH: to meet with (catch you later)CATTLE: human beings especially en masseCELL: a basic and usually small unit of an organization or movement (e.g., terrorist cells)CIRCUIT: an association of similar groups: a leagueCLAVE: to separate into distinct parts and especially into groups having divergent viewsCLEAVE: to separate into distinct parts and especially into groups having divergent viewsCLEFT: to separate into distinct parts and especially into groups having divergent viewsCLUB: an association of persons for some common object usually jointly supported and meeting periodically; also: a group identified by some common characteristic; also, the meeting place of a club; also, to unite or combine for a common causeCLUBBED: to unite or combine for a common causeCLUBBY: characteristic of a club or club members: such as displaying friendliness especially to other members of the same social group: sociable; also, open only to qualified or approved persons: select, eliteCOHORT: a band or group (a cohort of supporters); also, a companion or colleagueCOLOR: colored clothing distinguishing one as a member of a particular group or representative of a particular person or thing —usually used in plural (a jockey wearing the colors of the stable, wore his college colors to the game)COLOUR*: chiefly British spelling of color; colored clothing distinguishing one as a member of a particular group or representative of a particular person or thing —usually used in plural (a jockey wearing the colors of the stable, wore his college colors to the game)COMPANY: companions, associates (know a person by the company she keeps); association with another: fellowship (enjoy a person's company); visitors, guests (having company for dinner); also, to associate, to accompanyCOMPLEX: a group of culture traits relating to a single activity (such as hunting), process (such as use of flint), or culture unitCONNECT: to have or establish a rapport (with another person or group)CONNECTED: to have or establish a rapport (with another person or group)CONNECTION: to have or establish a rapport (with another person or group)COURT: to seek an alliance with; to seek to attract (as by solicitous attention or offers of advantages) (college teams courting high school basketball stars) (Both candidates were courting the independent voters.)CRAM: a compressed multitude or crowd: a crushDROP: to break off an association or connection with: dismiss (drop her old friends)DROPPING: to break off an association or connection with: dismiss (drop her old friends)FELLOW: a member of a group having common characteristics, specifically: a member of an incorporated literary or scientific societyFRAT: short for fraternity, a group of people associated or formally organized for a common purpose, interest, or pleasureFRATTY: M-W does not include this word, meaning “characteristic of a college fraternity or its members”GANG: a group of persons having informal and usually close social relationsGROUP: a number of individuals assembled together or having some unifying relationship (a study group); also, to form a group (The students grouped around the table.); also, to belong to a groupGROUPING: a number of individuals assembled together or having some unifying relationship (a study group); also, to form a group (The students grouped around the table.); also, to belong to a groupGUILD: an association of people with similar interests or pursuitsHUDDLE: a close-packed group: a bunch; also, to crowd together; to gather in a close-packed groupHUDDLED: a close-packed group: a bunch; also, to crowd together; to gather in a close-packed groupINVOLVE: to engage as a participant; also, to oblige to take partJOIN: to put or bring into close association or relationship; also, to come into the company of (another, or others)JOINED: to put or bring into close association or relationship; also, to come into the company of (another, or others)JOINING: to put or bring into close association or relationship; also, to come into the company of (another, or others)JOINT: involving the united activity of two or moreJUNTA: a junto, a group of persons joined for a common purposeLAITY: the mass of the people as distinguished from those of a particular profession or those specially skilledLATCH: to associate oneself intimately and often artfully —used with on or onto (latched onto a rich widow)LEAGUE: an association of persons or groups united by common interests or goals (a bowling league); also, an informal alliance (in league with her sister) also, to unite in a league; to form a leagueLEGION: a national association of ex-servicemen (the American Legion)LIMB: an active member or agent (a limb of the law)LOCAL: a local or particular branch, lodge, or chapter of an organization (such as a labor union)LODGE: the meeting place of a branch of an organization and especially a fraternal organization (a Masonic lodge); also, the body of members of such a branchMACHINE: a combination of persons acting together for a common end along with the agencies they useMAFIA: a group of people likened to the Mafia, especially: a group of people of similar interests or backgrounds prominent in a particular field or enterprise; a cliqueMAINLINE: (adj.) being part of an established groupMINGLE: to come into contact: to associate (he mingles only with millionaires); to move about (as in a group) (mingled with the guests)MINGLED: to come into contact: to associate (he mingles only with millionaires); to move about (as in a group) (mingled with the guests)MINGLING: to come into contact: to associate (he mingles only with millionaires); to move about (as in a group) (mingled with the guests)OUTFIT: a group that works as a team: an organization, especially: a military unitPACK: a set of persons with a common interest: a clique; also, an organized unit (as of Cub Scouts)PARTICIPANT: one that participates (participants in a contest)PARTOOK: to take part in or experience something along with othersPARTY: a person or group participating in an action or affair (a mountain-climbing party, a party to the transaction)PATROL: a subdivision of a Boy Scout troop or Girl Scout troopPEOPLE: human beings making up a group or assembly or linked by a common interest (they’re cycling people); also, a body of persons that are united by a common culture, tradition, or sense of kinship, that typically have common language, institutions, and beliefs, and that often constitute a politically organized groupPLAT: platoon [by shortening]: a group of persons sharing a common characteristic or activity (a platoon of waiters) PLATOON: a group of persons sharing a common characteristic or activity (a platoon of waiters) PLEDGE: a promise to join a fraternity, sorority, or secret society; also, a person who has so promisedPOOL: a group of people available for some purpose (a pool of applicants, a typing pool); also, to form a poolPOOLING: a group of people available for some purpose (a pool of applicants, a typing pool); also, to form a poolRANK: a row of people; also, an aggregate of individuals classed together —usually used in pluralROOM: the people in a room (The whole room cheered.)ROUNDUP: a gathering in of scattered persons or things (a roundup of all suspects)ROUT: a crowd of people, specifically: rabble, ordinary or common people lacking wealth, power, or social statusRUNNING: to keep company: consort (running with a fast crowd)TAKE: to bring or receive into a relation or connection (takes just four students a year) (it's time he took a wife); to accept in a usually professional relationship —often used with on (agreed to take him on as a client); to align or ally oneself with (mother took his side)TAKEN: to bring or receive into a relation or connection (takes just four students a year) (it's time he took a wife); to accept in a usually professional relationship —often used with on (agreed to take him on as a client); to align or ally oneself with (mother took his side)TEAM: a number of persons associated together in work or activity; also, to form a team or association : join forces or efforts —often used with upTEAMED: a number of persons associated together in work or activity; also, to form a team or association : join forces or efforts —often used with upTEAMMATE: a fellow member of a teamTOOK: to bring or receive into a relation or connection (takes just four students a year) (it's time he took a wife); to accept in a usually professional relationship —often used with on (agreed to take him on as a client); to align or ally oneself with (mother took his side)TRIBAL: of, relating to, or characteristic of a tribe; of, relating to, or characteristic of a community of people having shared ancestry, culture, and language; also, of, relating to, or characteristic of a group of people having a common character, occupation, or interest; also, characterized by tribalism: having or showing strong in-group loyalty and often a negative view of outsidersTRIBALLY: of, relating to, or characteristic of a tribe; of, relating to, or characteristic of a community of people having shared ancestry, culture, and language; also, of, relating to, or characteristic of a group of people having a common character, occupation, or interest; also, characterized by tribalism: having or showing strong in-group loyalty and often a negative view of outsidersTROOP: a collection of people: a crew, a group of people associated together in a common activity or by common traits or interests; also, the basic organizational unit of Scouts under an adult leader; also, to spend time together: to associate; also, to move or gather in crowds (We all trooped back in.); also, to move in large numbersTYPE: a member of an indicated class or variety of people (an outdoorsy type, the quiet type)UNION: often Union: something that is made one: something formed by a combining or coalition of parts or members, such as a confederation of independent individuals (such as nations or persons) for some common purpose (the European Union)UNITE: to link by a legal or moral bond (a purpose that unites the members of the group)UNITED: to link by a legal or moral bond (a purpose that unites the members of the group)UNITING: to link by a legal or moral bond (a purpose that unites the members of the group)WAVE: a large new group (as in an activity or profession) (the current wave of people interested in the industry)
Honorifics and Forms of Address not royalty, not clergy, not government, not military
CHAIR: an official seat or a seat of authority, state, or dignity; an office or position of authority or dignityCHIEF: accorded highest rank or office (chief librarian)CHIEFLY: of or relating to a chief (chiefly duties)COLONEL: a minor titular official of a state especially in southern or midland U.S., used as an honorific titleDAME: a female member of an order of knighthood —used as a title prefixed to the given nameDOCTOR: a learned or authoritative teacher; or a person who has earned one of the highest academic degrees (such as a PhD) conferred by a universityDUDE: a fellow, guy, sometimes used as a term of addressEMINENCE: a person of high rank or attainments —often used as a title for a cardinalEXCELLENCE: used as a title for high dignitaries of state (such as a governor or an ambassador) or church (such as a Roman Catholic archbishop or bishop)EXCELLENCY: used as a title for high dignitaries of state (such as a governor or an ambassador) or church (such as a Roman Catholic archbishop or bishop)GENTLEMAN: a man of noble or gentle birth, or a man belonging to the landed gentryGENTLEMEN: a man of noble or gentle birth, or a man belonging to the landed gentryHANDLE: a royal handle: an appellation of dignity, honor, distinction, or preeminence attached to a person or family by virtue of rank, office, precedent, privilege, attainment, or landsHONORAND: one that is awarded an honor (as an honorary degree)HONORARY: conferring or conveying honor (e.g., honorific titles); also, belonging to or constituting a class of grammatical forms used in speaking to or about a social superiorHONORIFIC: conferring or conveying honor (e.g., honorific titles); also, belonging to or constituting a class of grammatical forms used in speaking to or about a social superiorKIDDO: used as a familiar form of address [to a person of any age] (you'll be OK, kiddo)MADAM: lady —used without a name as a form of respectful or polite address to a woman (Right this way, madam.); also, Madam —used as a conventional form of address in the salutation of a letter; also, used as a title formerly with the given name but now with the surname or especially with a designation of rank or office (Madam Chairman, Madam President)MADAME: used as a title equivalent to Mrs. for a married woman not of English-speaking nationalityMAHATMA: a person to be revered for high-mindedness, wisdom, and selflessness; also, a person of great prestige in a field of endeavorMARM: M-W: chiefly dialectical: madam, used without a name as a form of respectful or polite address to a woman; alteration of ma'amOCCUPANT: one who acquires title by occupancyPANDIT: a wise or learned man in India —often used as an honorary titleRABBI: master, teacher —used by Jews as a term of addressTITLE: an appellation of dignity, honor, distinction, or preeminence attached to a person or family by virtue of rank, office, precedent, privilege, attainment, or lands; also, to designate or call by a title: to term, to styleTITLED: an appellation of dignity, honor, distinction, or preeminence attached to a person or family by virtue of rank, office, precedent, privilege, attainment, or lands; also, to designate or call by a title: to term, to styleTITLING: an appellation of dignity, honor, distinction, or preeminence attached to a person or family by virtue of rank, office, precedent, privilege, attainment, or lands; also, to designate or call by a title: to term, to styleTITULAR: (noun) a person holding a title; also, having the title and usually the honors belonging to an office or dignity without the duties, functions, or responsibilities (the titular head of the party)VEEP: vice president: any of several officers serving as a president's deputies in charge of particular locations or functions; ; from v.p. (abbreviation for vice president)
Individuals no particular characteristics
ANYONE: any person at allBLOKE: M-W’s only def.: chiefly British, informal: man, fellowBODY: a human being: person (e.g., what's a body to do?)BUCK: a male human beingBUDDY: a fellow, a person —used especially in informal addressCATTLE: human beings especially en masseDUCK: a person, creature (you lucky duck!)DUDE: a fellow, guy, sometimes used as a term of addressFOLK: people generally; also, a certain kind, class, or group of people (e.g., old folks)HUMAN: a bipedal primate mammal (Homo sapiens): a person: ; broadly: hominid; a man, a bipedal primate mammal (Homo sapiens) that is anatomically related to the great apes but distinguished especially by notable development of the brain with a resultant capacity for articulate speech and abstract reasoning, and is the sole living representative of the hominid family; broadly: any living or extinct hominidMILLION: the mass of common people —used with theMORTAL: (noun) a human beingMOUTH: an individual requiring food (many mouths to feed)NOBODY: no person: not anybody; a person of no influence or consequenceNONE: not one: nobody; not any such personPARTY: a particular individual: a person (she was the party for whom the job was created)PEOPLE: human beings, persons; also, to supply or fill with peoplePUBLIC: of or relating to people in general: universal; of, by, for, or directed to the public: popular (in the public eye; a campaign to raise public awareness of the issue); also, a group of people having common interests or characteristics, specifically: the group at which a particular activity or enterprise aimsPUBLICLY: of or relating to people in general: universal; of, by, for, or directed to the public: popular (in the public eye; a campaign to raise public awareness of the issue); also, a group of people having common interests or characteristics, specifically: the group at which a particular activity or enterprise aimsPUPPY: a person or thing, a baby (she’s one tough puppy)SLOB: an ordinary person (just some poor slob)SLOBS: an ordinary person (just some poor slob)THEE: thyself, yourself, used especially in ecclesiastical or literary language and sometimes by Quakers especially among themselves; also, the archaic objective case of thou, used especially in ecclesiastical or literary language and by Quakers especially among themselves in contexts where the objective case form would be expected; also, used by Quakers especially among themselves in contexts where the subjective case form would be expectedTHEM: they, used as the object of a verb or preposition to designate a group of people or things; also, used as the object of a verb or preposition to designate a single person whose gender is unknown, unspecified, or nonbinary; also, those used especially as an antecedent to a relative pronoun; also, used as the subject of a verb chiefly in nonstandard speech and for humorous effectTHEY: those ones : those people, animals, or things; used to refer to people in a general way or to a group of people who are not specified; used with a singular indefinite pronoun antecedent; used with a singular antecedent to refer to an unknown or unspecified person; used to refer to a single person whose gender is intentionally not revealed; used to refer to a single person whose gender identity is nonbinary (see nonbinary sense c)THINE: archaic: thy —used especially before a word beginning with a vowel or hthine; also, archaic: that which belongs to thee —used without a following noun as a pronoun equivalent in meaning to the adjective thy —used especially in ecclesiastical or literary language and still surviving in the speech of Quakers especially among themselvesTHING: an individual (not a living thing in sight)THOU: archaic: the one addressed; used especially in ecclesiastical or literary language and by Quakers as the universal form of address to one person; also, to address as thouTRULY: —often used with yours as a complimentary close (as of a letter) or humorously to refer to oneself ("Who's in charge here?" "Yours truly.")VARMINT: broadly: a person, a fellowVULGAR: of or relating to the common people: plebeianVULGARLY: of or relating to the common people: plebeianWAHINE: a Polynesian womanWAIF: a stray person or animal, especially: a homeless childWAIF: an extremely thin and usually young womanWIGHT: a living being: a creature, especially: a human beingWOMAN: an adult female person; also, womankind: female human beings: women especially as distinguished from men; also, a woman who is extremely fond of or devoted to something specified (I'm a chocolate woman through and through); also, a woman belonging to a particular category (as by birth, residence, membership, or occupation) —usually used in combination (a councilwoman)WOMEN: plural of woman, an adult female person; also, womankind: female human beings: women especially as distinguished from men; also, a woman who is extremely fond of or devoted to something specified (I'm a chocolate woman through and through); also, a woman belonging to a particular category (as by birth, residence, membership, or occupation) —usually used in combination (a councilwoman)WORLD: the inhabitants of the earth: the human race (all the world); the whole body of living persons: public (announced their discovery to the world); a division or generation of the inhabitants of the earth distinguished by living together at the same place or at the same time (the medieval world); a distinctive class of persons or their sphere of interest or activitythe academic world (the digital world)YOUR: of or relating to you or yourself or yourselves especially as possessor or possessors (your bodies), agent or agents (your contributions), or object or objects of an action (your discharge); also, of or relating to one or oneself (when you face the north, east is at your right); also, —used with little or no meaning almost as an equivalent to the definite article the (your typical teenager)YOUTH: a young person, especially: a young male between adolescence and maturity; young persons or creatures —usually plural in construction
Life, Living, Carrying On
AFFAIR: commercial, professional, public, or personal businessCLOAK: a distinctive character or role (… hung up his academic cloak … to become a stay-at-home father …—Charles Chamberlain)FIND: to bring (oneself) to a realization of one's powers or of one's proper sphere of activity (she went off to find herself); to be affected by (something) in a particular way (found walking painful after the injury); to perceive (oneself) to be in a certain place, situation, or condition (found himself in a forest clearing, found myself agreeing with her); to meet with (a particular experience) (hoped to find favor)FINDING: to bring (oneself) to a realization of one's powers or of one's proper sphere of activity (she went off to find herself); to be affected by (something) in a particular way (found walking painful after the injury); to perceive (oneself) to be in a certain place, situation, or condition (found himself in a forest clearing, found myself agreeing with her); to meet with (a particular experience) (hoped to find favor)FLOAT: to live without a serious purpose or goal (she floats through life)FOUND: to bring (oneself) to a realization of one's powers or of one's proper sphere of activity (she went off to find herself); to be affected by (something) in a particular way (found walking painful after the injury); to perceive (oneself) to be in a certain place, situation, or condition (found himself in a forest clearing, found myself agreeing with her); to meet with (a particular experience) (hoped to find favor)GOING: present participle of to go, to proceed along or according to: to follow (going the usual way) —often used figuratively (He has always gone his own way.)GONE: past participle of to go, to proceed along or according to: to follow (going the usual way) —often used figuratively (He has always gone his own way.)HIDE: the life or physical well-being of a person (betrayed his friend to save his own hide)HOBO: often disparaging: a usually very poor person who has no permanent residence and travels from place to place especially by furtively hopping trains; also, a migrant worker; also, to live or travel in the manner of a hoboHOBOS: often disparaging: a usually very poor person who has no permanent residence and travels from place to place especially by furtively hopping trains; also, a migrant worker; also, to live or travel in the manner of a hoboLIFE: the period from birth to death; also, the sequence of physical and mental experiences that make up the existence of an individual; human activities; a specific phase of earthly existence (adult life); a way or manner of living (the life of the colonists); one or more aspects of the process of living (sex life of the frog); also, the period from an event until death (a judge appointed for life); also, (adj.) lifelong (a life member)LIFELONG: lasting or continuing through life; long-standingLIFETIME: lifelong; of long duration or continuance; measured or achieved over the span of a career (a baseball player's lifetime batting average); the period of duration, usefulness, or popularity of something; also, the duration of the existence of a living being (such as a person or an animal) or a thing (such as a star or a subatomic particle)LINE: scope for activityLIVE: to maintain oneself: to subsist (lived on rice and peas); to conduct or pass one's life (lived only for his work); to act out, to practice —often used with out (to live out their fantasies); to be thoroughly absorbed by or involved with (she lives her work)LIVED: to maintain oneself: to subsist (lived on rice and peas); to conduct or pass one's life (lived only for his work); to act out, to practice —often used with out (to live out their fantasies); to be thoroughly absorbed by or involved with (she lives her work)LIVING: to maintain oneself: to subsist (lived on rice and peas); to conduct or pass one's life (lived only for his work); to act out, to practice —often used with out (to live out their fantasies); to be thoroughly absorbed by or involved with (she lives her work)MOVE: to carry on one's life or activities in a specified environment (moves in the best circles)MOVED: to carry on one's life or activities in a specified environment (moves in the best circles)ORBIT: a range or sphere of activity or influencePATH: a way of life, conduct, or thought (career path)RAID: a brief foray outside one's usual sphereREVELER: one who engages in revelry, noisy partying or merrymakingROVER: a wanderer, a roamerTHING: a matter of concern: affair (many things to do); TIME: a person's experience during a specified period or on a particular occasion (a good time, a hard time)TRACK: a way of life, conduct, or action (he finally got himself back on track)TRIP: informal: scene, lifestyle (the whole superstar trip)TURF: a sphere of activity or influenceVAGABOND: a person who wanders from place to place without a fixed home: one leading a vagabond life, especially: a vagrant, a tramp; (adj) moving from place to place without a fixed home: wandering; of, relating to, or characteristic of a wanderer; also, to wander in the manner of a vagabond: to roam about; leading an unsettled, irresponsible, or disreputable lifeVAGRANT: usually disparaging: someone who has no established residence and wanders idly from place to place without lawful or visible means of support; also, someone whose conduct constitutes vagrancy under state statute or other applicable law or regulation; (adj) wandering about from place to place usually with no means of support; a wanderer, a roverVALE: world [in which we live] (this vale of tears)WALK: social or economic status (all walks of life); range or sphere of action: field, province; vocation; manner of living: conduct, behavior; to pursue a course of action or way of life: to conduct oneself: to behave (walk warily)WEAN: to accustom to something from an early age —used in the passive especially with on (I was weaned on greasepaint —Helen Hayes)WEANED: to accustom to something from an early age —used in the passive especially with on (I was weaned on greasepaint —Helen Hayes)WEANING: to accustom to something from an early age —used in the passive especially with on (I was weaned on greasepaint —Helen Hayes)WEDDED: to link by commitment or custom (was wed to the old ways)WEDDING: to link by commitment or custom (was wed to the old ways)WENT: past tense of to go, to proceed along or according to: to follow (going the usual way) —often used figuratively (He has always gone his own way.)WILD: characteristic of, appropriate to, or expressive of wilderness, wildlife, or a simple or uncivilized societyWORLD: the earthly state of human existence; individual course of life: career; the sphere or scene of one's life and action (living in your own little world); the concerns of the earth and its affairs as distinguished from heaven and the life to come; secular affairsWORLDLY: of, relating to, or devoted to this world and its pursuits rather than to religion or spiritual affairs; possessing or displaying significant experience and knowledge about life and the world: worldly-wise
Romance and Marriage
AFFAIR: a romantic or passionate attachment typically of limited durationAFFIANCE: to solemnly promise (oneself or another) in marriage: betrothAFFIANCING: to solemnly promise (oneself or another) in marriage: betrothAFFINITY: relationship by marriage; also, a person especially of the opposite sex having a particular attraction for oneALTAR: often used with “the” to refer to the act of getting marriedATTENTIVE: offering attentions in or as if in the role of a suitorBEAU: a boyfriendBOOS: plural of boo, US slang: a romantic partner : sweetheart, honeyBRIDAL: a marriage festival or ceremony; also, of or relating to a bride or a wedding: nuptial; also, intended for a newly married coupleBUNDLING: a former custom of an unmarried couple's occupying the same bed without undressing especially during courtshipCATCH: one worth catching especially as a spouse (she’s a real catch)CELIBACY: the state of not being married; abstention by vow from marriageCOMMITMENT: the state of being in a serious usually long-term and monogamous emotional relationshipCOMMITTAL: commitment: the state of being in a serious usually long-term and monogamous emotional relationshipCONTRACT: the act of marriage or an agreement to marry; also, to betroth; also: to establish (a marriage) formallyCOUPLE: two persons married, engaged, or otherwise romantically paired; also, to join in marriage or sexual union; to unite in sexual unionCOUPLED: two persons married, engaged, or otherwise romantically paired; also, to join in marriage or sexual union; to unite in sexual unionCOURT: to seek the affections of, especially: to seek to win a pledge of marriage from; to engage in social activities leading to engagement and marriageCRAZILY: absurdly fond: infatuated (He's crazy about the girl.)CRAZY: absurdly fond: infatuated (He's crazy about the girl.)DATE: a social engagement between two persons that often has a romantic character (asked her out on a date); also, a person with whom one has a usually romantic date (bringing a date to the dance); also, to make a usually romantic social arrangement to meet with: to have a date with (someone she dated in high school); also, to go out on usually romantic dates (wasn't allowed to date until she was sixteen)DATED: a social engagement between two persons that often has a romantic character (asked her out on a date); also, a person with whom one has a usually romantic date (bringing a date to the dance); also, to make a usually romantic social arrangement to meet with: to have a date with (someone she dated in high school); also, to go out on usually romantic dates (wasn't allowed to date until she was sixteen)DATING: a social engagement between two persons that often has a romantic character (asked her out on a date); also, a person with whom one has a usually romantic date (bringing a date to the dance); also, to make a usually romantic social arrangement to meet with: to have a date with (someone she dated in high school); also, to go out on usually romantic dates (wasn't allowed to date until she was sixteen)DUMP: often, informal: to end a romantic relationship with (someone)DUMPED: often, informal: to end a romantic relationship with (someone)ELECT: (adj.) chosen for marriage at some future time (the bride-elect)ELOPE: to run away secretly with the intention of getting marriedENGAGE: to bind (someone, such as oneself) to do something, especially: to bind by a pledge to marryENGAGED: pledged to be married: betrothed; also, to bind (someone, such as oneself) to do something, especially: to bind by a pledge to marryENGAGEMENT: the act of engaging: the state of being engaged; a betrothalENGAGING: to bind (someone, such as oneself) to do something, especially: to bind by a pledge to marryFAVOR: a token of love (such as a ribbon) usually worn conspicuouslyFELLOW: boyfriend, beauFIANCE: fiancé: a man engaged to be marriedFIANCEE: fiancée: a woman engaged to be marriedFLAME: a sweetheart, someone who is loved, often, specifically: a romantic partner (saw his old flame last week)FLING: a casual or brief love affairFLINGING: a casual or brief love affairFLIRT: to behave amorously without serious intent; also, an act or instance of flirting; also, a person who flirtsFLIRTY: flirtatious: inclined to flirt, to behave amorously without serious intentGALLANT: a ladies' man; a suitor; also, courteously and elaborately attentive especially to ladies; also, to pay court to (a lady): to attend; to be a suitorGALLANTRY: amorous attention or pursuitGILL: a girl, sweetheart [soft g] Middle English, from Gill, nickname for GillianGIRL: a female romantic partner: a girlfriend; also, sometimes offensive: a single or married woman of any ageGROOM: a bridegroomHAND: a pledge especially of betrothal or bestowal in marriage (he asked for her hand in marriage)HAVE: to accept in marriageHITCH: to join in marriage; to become joined in marriageHITCHED: to join in marriage; to become joined in marriageHITCHING: to join in marriage; to become joined in marriageHOMOGAMY: the mating of like with like [e.g., from the same demographic]HONEY: a loved one: sweetheart, dearHONEYBUN: M-W: variant of honeybunch, a loved one: sweetheart, dearHONEYMOON: a period of harmony immediately following marriage; or a period of unusual harmony especially following the establishment of a new relationship; or a trip or vacation taken by a newly married couple; or (Collins) to have or spend a honeymoonHONEYMOONED: a period of harmony immediately following marriage; or a period of unusual harmony especially following the establishment of a new relationship; or a trip or vacation taken by a newly married couple; or (Collins) to have or spend a honeymoonHUBBY: husbandIMPEDIMENT: a bar or hindrance (such as lack of sufficient age) to a lawful marriageINTENTION: intentions plural: purpose with respect to marriage (What are your intentions with regard to Elfrida?)INVOLVE: to occupy (someone, such as oneself) absorbingly especially: to commit (someone) emotionallyITEM: a couple in a romantic or sexual relationshipKNOT: a bond of union, especially: the marriage bond (tie the knot)LADY: wife, girlfriend, mistressLINE: lines plural: a certificate of marriageLORD: a husbandLOVE: an amorous episode: a love affair; affection and tenderness felt by lovers (they are in love); to feel affection or experience desireLOVED: an amorous episode: a love affair; affection and tenderness felt by lovers (they are in love); to feel affection or experience desireLOVELORN: bereft of love or of a loverLOVER: a person in love; lovers plural: two persons in love with each other; a paramour (Her husband found a love letter from her lover.)LOVING: an amorous episode: a love affair; affection and tenderness felt by lovers (they are in love); to feel affection or experience desireMARITAL: of or relating to marriage or the married stateMARITALLY: of or relating to marriage or the married stateMARRY: to join in marriage according to law or custom; to find a marriage partner for (someone, especially one's child); to take as spouse: to wed; to perform the ceremony of marriage for; to obtain by marriage (marry wealth)MATCH: a marriage union; also, a prospective partner in marriage; also, to join or give in marriageMATCHED: a marriage union; also, a prospective partner in marriage; also, to join or give in marriageMATCHMAKE: to bring about a marriage especially by schemingMATE: either member of a couple and especially a married couple; also, to join together as matesMATED: either member of a couple and especially a married couple; also, to join together as matesMATING: either member of a couple and especially a married couple; also, to join together as matesMOLL: a darling, sweetheart; also, a gangster's girlfriend; probably from Moll, nickname for MaryMONOGAMY: the state or custom of being married to only one person at a timeNUBILE: of marriageable condition or age (nubile young women)NUPTIAL: of or relating to marriage or the marriage ceremony (nuptial vows); also, used in plural, a wedding or marriageOPEN: of a relationship: not restricted to one partner at a time by mutual agreement (an open marriage)PAIR: a couple in love, engaged, or married (they were a devoted pair); also, to make a pair of —often used with off or upPAIRING: a couple in love, engaged, or married (they were a devoted pair); also, to make a pair of —often used with off or upPARAMOUR: a lover; specifically: an illicit or secret loverPINNED: to present (a young woman) with a fraternity pin as a pledge of affectionPINNING: to present (a young woman) with a fraternity pin as a pledge of affectionPOLYGAMY: marriage in which a spouse of either sex may have more than one mate at the same time; also, the state of being polygamousPORTION: a dowry, the money, goods, or estate that a woman brings to her husband in marriage; also, to allot a dowry to: to dower, to supply with a dower or dowry: to endowTHROUGH: no longer in a romantic relationship (told him they were through)TIED: to unite in marriageTORRID: ardent, passionate (torrid love letters)TORRIDITY: torridness, the quality or state of being torrid: ardent, passionate (torrid love letters)TOYED: to toy: to engage in flirtationTROTH: betrothal: the act of betrothing or fact of being betrothed, a mutual promise or contract for a future marriageTYING: to unite in marriageTYPE: a member of a group of people with the particular characteristics that someone finds attractive in a romantic partner (He's not her type.)UNENGAGED: not engaged: not pledged or promised, specifically not promised in marriage (agreed to continue seeing him but on an unengaged basis)UNION: a uniting in marriageUNWED: not married (an unwed father, unwed couples); also, of or relating to unmarried persons (an unwed pregnancy)UNWEDDED: not in M-W (M-W has only “unwed”); Collins has “unwedded: in British English, adjective, another name for unwed; unwed: in British English, adjective, old-fashioned, another word for unmarried”VALENTINE: a sweetheart chosen or complimented on Valentine's Day (February 14, observed in honor of St. Valentine and as a time for sending valentines); also, a gift or greeting sent or given especially to a sweetheart on Valentine's Day, especially: a greeting card sent on this day; from Late Latin Valentinus, the name of two early Italian saints, esp St Valentine, whose feast day is February 14VIRGIN: an absolutely chaste young woman; an unmarried girl or womanWEDDED: to take for wife or husband by a formal ceremony: to marry; to join in marriage; to enter into matrimonyWEDDING: a marriage ceremony usually with its accompanying festivities: nuptials; also, a wedding anniversary or its celebration (a golden wedding); also, to take for wife or husband by a formal ceremony: to marry; to join in marriage; to enter into matrimonyWEDLOCK: the state of being married: marriage, matrimonyWIDOW: a woman who has lost her spouse or partner by death and usually has not remarried; also, a grass widow, woman whose husband is temporarily away from her, or a woman divorced or separated from her husband; also, a woman whose spouse or partner leaves her alone or ignores her frequently or for long periods to engage in a usually specified activity (a golf widow, a video game widow); also, to cause to become a widow or widowerWIDOWED: a woman who has lost her spouse or partner by death and usually has not remarried; also, a grass widow, woman whose husband is temporarily away from her, or a woman divorced or separated from her husband; also, a woman whose spouse or partner leaves her alone or ignores her frequently or for long periods to engage in a usually specified activity (a golf widow, a video game widow); also, to cause to become a widow or widowerWIDOWHOOD: the fact or state of being a widow; also, the period during which a woman remains a widow; also, widowerhood, the fact or state of being a widower; the period during which a man remains a widowerWINNING: to induce to accept oneself in marriage (was unable to win the woman he loved)WOMAN: a mistress, a woman other than one's spouse with whom a married person has a continuing sexual relationship; also, a girlfriend, a frequent or regular female companion in a romantic or sexual relationshipWOMEN: plural of woman, a mistress, a woman other than one's spouse with whom a married person has a continuing sexual relationship; also, a girlfriend, a frequent or regular female companion in a romantic or sexual relationshipWOOED: to sue for the affection of and usually marriage with: to court; especially, to court a womanWOOING: to sue for the affection of and usually marriage with: to court; especially, to court a woman
Self, Solitude, Isolation
ALIENATE: to cause to be estranged: to make unfriendly, hostile, or indifferent especially where attachment formerly existedALONE: separated from others: isolated; without aid or supportALOOF: removed or distant either physically or emotionally; at a distanceALOOFLY: removed or distant either physically or emotionally; at a distanceAPART: separate, isolatedATOMIZATION: to deprive of meaningful ties to others (atomized individuals)AVOID: to keep away from: to shun (They have been avoiding me.)BANNED: to bar entry; to keep out, to excludeBANNING: to bar entry; to keep out, to excludeBARRING: to keep out: exclude —often used with from (women were barred from joining the club.)BLACKBALL: to vote against, especially: to exclude from membership by casting a negative vote; to exclude socially: ostracize; boycott; also, a small black ball for use as a negative vote in a ballot box; also, an adverse vote especially against admitting someone to membership in an organizationCIVILIAN: an outsider, a person who does not belong to a particular groupCOLONY: a group of persons institutionalized away from others (a leper colony, a penal colony); also: the land or buildings used by such a groupDEMIMONDE: a distinct circle or world that is often an isolated part of a larger world, especially: one having low reputation or prestigeDROPOUT: one who drops out of conventional society; one who abandons an attempt, activity, or chosen pathEJECT: to throw out especially by physical force, authority, or influence (ejected the player from the game)EJECTABLE: to throw out especially by physical force, authority, or influence (ejected the player from the game)EJECTED: to throw out especially by physical force, authority, or influence (ejected the player from the game)EJECTION: to throw out especially by physical force, authority, or influence (ejected the player from the game)EXPEL: to force to leave (a place, an organization, etc.) by official action: take away rights or privileges of membershipEXPELLEE: a person who is expelledGHETTO: an isolated group, or a situation that resembles a ghetto especially in conferring inferior status or limiting opportunityHIDDEN: to seek protection or evade responsibility (hides behind his dark glasses, hoping to avoid being recognized)HIDE: to seek protection or evade responsibility (hides behind his dark glasses, hoping to avoid being recognized)HIDING: to seek protection or evade responsibility (hides behind his dark glasses, hoping to avoid being recognized)LONE: having no company: solitary; preferring solitudeLONELY: being without company: lone; cut off from others: solitary (lonely little towns)MAROON: to put ashore on a desolate island or coast and leave to one's fate; to place or leave in isolation or without hope of ready escape; a person who is maroonedORPHAN: one deprived of some protection or advantage (orphans of the storm)OUTLAW: also, a person or organization under a ban or restriction; also, to declare to be an outlaw; to place under a ban or restrictionPARIAH: someone or something that is despised or rejected: an outcast, one that is cast out or refused acceptance (as by society)PILL: to blackball: to vote against, especially: to exclude from membership by casting a negative vote [with a pill, another word for a blackball]; to exclude socially: to ostracizePILLED: to blackball: to vote against, especially: to exclude from membership by casting a negative vote [with a pill, another word for a blackball]; to exclude socially: to ostracizePILLING: to blackball: to vote against, especially: to exclude from membership by casting a negative vote [with a pill, another word for a blackball]; to exclude socially: to ostracizePRIVACY: the quality or state of being apart from company or observation: seclusion; freedom from unauthorized intrusion (one's right to privacy)PRIVY: belonging or relating to a person in one's individual rather than official capacityPRIVY: private, withdrawnQUIET: secluded (a quiet nook)RIFT: a breach, estrangement (a rift in the family)TRAMP: having no fixed abode, connection, or destination (a tramp dog, a tramp worker); also, a vagrant, usually disparaging: someone who has no established residence and wanders idly from place to place without lawful or visible means of supportUNATTENDED: not attended: not watched or looked after: lacking a guard, escort, caretaker, etc.WITHDRAW: to remove oneself from participation; to become socially or emotionally detachedWITHIN: in one's inner thought, disposition, or character: inwardly
Sexuality and Sexual Behavior
ACTION: sexual activityADULT: dealing in or with explicitly sexual materialAMATORY: of, relating to, or expressing sexual loveAMOUR: a usually illicit love affair; also, a loverARDOR: an often restless or transitory warmth of feeling; sexual excitement BANG: vulgar slang: an act of copulation; a sexual partner; also, vulgar slang: to have sexual intercourse withBANGED: vulgar slang: an act of copulation; a sexual partner; also, vulgar slang: to have sexual intercourse withBANGING: vulgar slang: an act of copulation; a sexual partner; also, vulgar slang: to have sexual intercourse withBAWD: one who keeps a house of prostitution: a madam; also, a prostituteBOINK: sometimes vulgar: to copulate withBONE: US, vulgar slang: to have sexual intercourse with (someone)BONED: US, vulgar slang: to have sexual intercourse with (someone)BOOTIE: more commonly booty, US slang: sexual intercourseBOOTY: or less commonly bootie, US slang: sexual intercourseBULLY: a pimpCAME: often vulgar: semen or orgasm; also, often vulgar: to experience orgasmCARNAL: marked by sexuality (carnal love)CARNALLY: marked by sexuality (carnal love)CELIBACY: abstention from sexual intercourseCELIBATE: not engaging in or characterized by sexual intercourse; a person who abstains from sexual intercourse; a person who lives in celibacy: a celibate person; an unmarried personCHEAT: to be sexually unfaithful —usually used with onCHICKEN: slang: a young or youthful gay man; also: a boy or young man regarded as an object of sexual interest especially by a manCOITAL: related to coitus, sexual contact involving penetration of the vagina by the penis: sexual intercourseCOME: often vulgar: semen or orgasm; also, often vulgar: to experience orgasmCOMING: often vulgar: semen or orgasm; also, often vulgar: to experience orgasmCONDOM: a sheath commonly of rubber worn over the penis (as to prevent conception or venereal infection during coitus); also, a device that is designed to be inserted into the vagina before coitus and that resembles in form and function the condom used by malesCONTINENCE: self-restraint, especially: refraining from sexual intercourseCOYLY: marked by cute, coquettish, or artful playfulnessDALLIED: to act playfully, especially: to play amorouslyDALLY: to act playfully, especially: to play amorouslyDALLYING: to act playfully, especially: to play amorouslyDEMIMONDE: a class of women on the fringes of respectable society supported by wealthy lovers; also, their world. Or, the world of prostitution.DIDDLE: usually vulgar: to copulate withDIDDLED: usually vulgar: to copulate withDIDDLING: usually vulgar: to copulate withDILDO: an object resembling a penis used for sexual stimulationDIRT: licentiousness of language or themeDIRTY: licentiousness of language or themeDRAB: a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex worker; also, to associate with sex workers EASY: sexually promiscuousENTICE: to attract artfully or adroitly or by arousing hope or desire: to temptENTICED: to attract artfully or adroitly or by arousing hope or desire: to temptENTICEMENT: to attract artfully or adroitly or by arousing hope or desire: to temptENTICING: to attract artfully or adroitly or by arousing hope or desire: to temptFAVOR: sexual privileges —used in pluralFELLATE: to perform fellatio onFELLATED: to perform fellatio onFLIRT: to behave amorously without serious intent; also, an act or instance of flirting; also, a person who flirtsFLIRTY: flirtatious: inclined to flirt, to behave amorously without serious intent FLORID: marked by emotional or sexual fervor (a florid secret life, a florid sensibility)FLORIDLY: in a florid manner: with floridity; marked by emotional or sexual fervor (a florid secret life, a florid sensibility)FONDLING: to touch (someone or something) sexually; to show desire by caressingFOOTIE: M-W: variant of footsie, a furtive flirtatious caressing with the feet (as under a table)GALLANT: a ladies' man; a suitor; a paramour (an illicit or secret lover)GAMY: sordid, scandalous: sexually suggestive: racyGAVE: dated, of a woman: to yield (oneself) to a man in sexual intercourseGAYDAR: slang: the supposed ability to recognize through observation or intuition that a person is gay; blend of gay + radarGIGOLO: a man who is paid to be a sexual partner and companion; also, a male sex worker hired to attend a social engagement with someone: a man who is an escort; also, dated: a man who is paid to be a dancing partnerGIVE: dated, of a woman: to yield (oneself) to a man in sexual intercourseGIVEN: dated, of a woman: to yield (oneself) to a man in sexual intercourseGIVING: dated, of a woman: to yield (oneself) to a man in sexual intercourseHOOK: to work as a prostituteHORNY: desiring sexual gratification; excited sexuallyIMPOTENT: unable to engage in sexual intercourse because of inability to have and maintain an erectionINCONTINENCE: failure to restrain sexual appetiteINCONTINENT: failing to restrain sexual appetiteINNOCENCE: chastityINTIMATE: engaged in, involving, or marked by sex or sexual relationsITCH: lust, prurienceKINK: unconventional sexual taste or behaviorKINKILY: relating to, having, or appealing to unconventional tastes especially in sex; also: sexually deviantKINKY: relating to, having, or appealing to unconventional tastes especially in sex; also: sexually deviantLAID: to lay: often vulgar: to copulate withLAID: to lie: to have sexual intercourse —used with with (to lie with)LAIN: to lie: to have sexual intercourse —used with with (to lie with)LAYING: to lay: often vulgar: to copulate withLECH: [noun] [by shortening] letch: craving, specifically: sexual desire; also, a lecher; also [verb] to lustLETCH*: [noun] [by shortening & alteration]: craving, specifically: sexual desire; also, a lecherLEWD: sexually unchaste or licentiousLIBIDINAL: of or relating to the libidoLIBIDO: sexual driveLIGHT: sexually promiscuousLOVE: attraction based on sexual desire; also, the sexual embrace: copulation; also, to feel desire; to feel a lover's passion, devotion, or tenderness for; to fondle amorously; to copulate withLOVED: attraction based on sexual desire; also, the sexual embrace: copulation; also, to feel desire; to feel a lover's passion, devotion, or tenderness for; to fondle amorously; to copulate with LOVER: a person with whom one has sexual relations (He was her first lover); a paramour (Her husband found a love letter from her lover.)LOVING: attraction based on sexual desire; also, the sexual embrace: copulation; also, to feel desire; to feel a lover's passion, devotion, or tenderness for; to fondle amorously; to copulate withLYING: to lie: to have sexual intercourse —used with with (to lie with)MADAM: a woman who runs a brothelMADAME: a madam, a woman who runs a brothelMADE: to persuade to consent to sexual intercourse: to seduceMAID: an unmarried girl or woman especially when young; a virginMAKE: to persuade to consent to sexual intercourse: to seduceMAKING: to persuade to consent to sexual intercourse: to seduceMATE: to copulateMATED: to copulateMATING: to copulateMONOGAMY: the state or practice of having only one sexual partner at a timeNAIL: usually vulgar: to copulate withNAILING: usually vulgar: to copulate withNECK: to kiss and caress amorously; to engage in amorous kissing and caressingNECKED: to kiss and caress amorously; to engage in amorous kissing and caressingNECKING: to kiss and caress amorously; to engage in amorous kissing and caressingNUBILE: sexually attractive —used of a young womanOGLE: an amorous or coquettish glance; also, to glance with amorous invitation or challenge, to eye amorously or provocatively, to look at especially with greedy or interested attentionOGLED: an amorous or coquettish glance; also, to glance with amorous invitation or challenge, to eye amorously or provocatively, to look at especially with greedy or interested attentionOGLING: an amorous or coquettish glance; also, to glance with amorous invitation or challenge, to eye amorously or provocatively, to look at especially with greedy or interested attentionORGY: a sexual encounter involving many people; also: an excessive sexual indulgencePARAMOUR: a lover; specifically: an illicit or secret loverPAWING: to feel or touch clumsily, rudely, or sexually; to feel or touch someone or something clumsily, rudely, or sexuallyPETTED: to engage in amorous embracing, caressing, and kissing: to neckPIECE: vulgar: an act of copulation; also, vulgar: the female partner in sexual intercoursePIMP: a person and especially a man who controls one or more sex workers, arranges clients for them, and takes a cut of their earnings; also, to work as a pimpPIMPED: a person and especially a man who controls one or more sex workers, arranges clients for them, and takes a cut of their earnings; also, to work as a pimpPIMPING: a person and especially a man who controls one or more sex workers, arranges clients for them, and takes a cut of their earnings; also, to work as a pimpPLAY: to have sexual relations, especially: to have promiscuous or illicit sexual relations —usually used in the phrase play around; also, a move or series of moves calculated to arouse friendly feelings —usually used with make (to make a play for someone); amorous flirtation: dalliancePOUT: to push out or purse the lips in a sexually suggestive way (a pouting model)POUTED: to push out or purse the lips in a sexually suggestive way (a pouting model)PRIAPIC: relating to or preoccupied with virility or male sexual excitementPUNK: slang: a young man used as a sexual partner by another man especially in a prisonRACILY: risqué, suggestive (racy jokes)RACY: risqué, suggestive (racy jokes)RANDY: lustful, lecherousROMP: an episode of lovemakingTAIL: slang, vulgar: sexual intercourseTAKE: to copulate withTAKEN: to copulate withTART: informal + disapproving: a woman who has multiple sexual partners: a woman who is sexually promiscuous; also, a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerTOMCAT: to seek sexual gratification promiscuously: to cat —often used with aroundTOOK: to copulate withTRAMP: disparaging: a woman who has multiple sexual partners: a woman who is sexually promiscuous; also, disparaging: a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerTRICK: informal: a sexual act performed by a sex worker (She was living on the street and turning tricks [=taking payment for sex acts] to survive.); also, a john, a sex worker's clientTROLLOP: a vulgar or disreputable woman, especially: one who engages in sex promiscuously or for moneyTRULL*: old-fashioned + usually disparaging: a woman who engages in sex acts and especially sexual intercourse in exchange for pay: a woman who is a sex workerTURN: informal: to engage in (a sex act as a sex worker) (turning tricks [=taking payment for performing sex acts])UNDID: to seduce, to carry out the physical seduction of: to entice to sexual intercourseUNDO: to seduce, to carry out the physical seduction of: to entice to sexual intercourseUNDOING: to seduce, to carry out the physical seduction of: to entice to sexual intercourseUNDONE: to seduce, to carry out the physical seduction of: to entice to sexual intercourseUNION: sexual intercourseVAMP: a woman who uses her charm or wiles to seduce and exploit men; short for vampire, one who lives by preying on others, especially a woman who exploits and ruins her lover; also, to practice seductive wiles on; to act like a vamp (vamping for the camera)VIBRATOR: one that vibrates or causes vibration: such as a vibrating electrical apparatus used in massage or for sexual stimulationVICE: disapproving: uninhibited sexual behavior; also, sex workVIRGIN: a person who has not had sexual intercourse; an absolutely chaste young woman; an unmarried girl or woman; also, (adj) chasteWANTON: (adj) lewd, bawdy; causing sexual excitement: lustful, sensual; also, one given to self-indulgent flirtation or trifling —used especially in the phrase play the wanton; also, a lewd or lascivious personWARM: emphasizing or exploiting sexual imagery or incidentsWHITE: marked by the wearing of white by the woman as a symbol of [sexual] purity (a white wedding)WOLF: a man [who is] forward, direct, and zealous in amatory attentions to womenWOMAN: a mistress, a woman other than one's spouse with whom a married person has a continuing sexual relationship; also, a girlfriend, a frequent or regular female companion in a romantic or sexual relationshipWOMEN: plural of woman, a mistress, a woman other than one's spouse with whom a married person has a continuing sexual relationship; also, a girlfriend, a frequent or regular female companion in a romantic or sexual relationship
Where We Live private homes and neighborhoods
ABED: in bedABODE: the place where one lives: homeBACKYARD: a nearby area: neighborhood; also, an area at the rear of a house; also, located or occurring in a backyard (a backyard barbecue)BARRACK: a structure resembling a shed or barn that provides temporary housingBLOCK: a line of row houses, one of a series of houses connected by common sidewalls and forming a continuous groupBLOCKS: a line of row houses, one of a series of houses connected by common sidewalls and forming a continuous groupCABANA: a lightweight structure with living facilitiesCABIN: a small one-story dwelling usually of simple constructionCELL: a one-room dwelling occupied by a solitary person (such as a hermit) CHALET: a remote herdsman's hut in the Alps; also, a Swiss dwelling with unconcealed structural members and a wide overhang at the front and sides; also, a cottage or house in chalet styleCHATEAU: M-W has château; plural châteaux [or châteaus]: a large country house: mansion; also, a French vineyard estateCHATEAUX: M-W has château; plural châteaux [or châteaus]: a large country house: mansion; also, a French vineyard estateCOLONY: a group of people who settle together in a new place; also: the land or buildings used by such a group; also, a group of individuals or things with common characteristics or interests living in close association (an artist colony; also: the land or buildings used by such a group; also, a group of persons institutionalized away from others (a leper colony, a penal colony); also: the land or buildings used by such a groupCOMPLEX: a building or group of buildings housing related unitsCOMPOUND: a fenced or walled-in area containing a group of buildings and especially residencesCONDO: individual ownership of a unit in a multiunit structure (such as an apartment building) or on land owned in common (such as a town house complex); also: a unit so owned, or a building containing condominiumsCONDOMINIUM: individual ownership of a unit in a multiunit structure (such as an apartment building) or on land owned in common (such as a town house complex); also: a unit so owned, or a building containing condominiumsCOTENANT: one who is a tenant along with one or more other tenantsCOTTAGE: the dwelling of a farm laborer or small farmer; also, a usually small frame one-family house; also, a small detached dwelling unit at an institution; also, a usually small house for vacation useCOURT: a manor house or large building surrounded by usually enclosed grounds (Hampton Court)DACHA: a Russian country cottage used especially in the summerDEAD: devoid of former occupants (dead villages)DOMICILE: a dwelling place: place of residence: home; also, in law, a person's fixed, permanent, and principal home for legal purposesDORM: a dormitoryDORMITORY: a room for sleeping; especially: a large room containing numerous beds; a residence hall providing rooms for individuals or for groups usually without private bathsDWELL: to live as a residentDWELLED: to live as a residentDWELLING: a shelter (such as a house) in which people live; also, to live as a residentDWELT: to live as a residentEMPTY: not occupied or inhabited (an empty building); unfrequentedEVICT: to put (a tenant) out by legal processEVICTED: to put (a tenant) out by legal processEVICTEE: an evicted personEVICTION: to put (a tenant) out by legal processFLATMATE: M-W’s only definition: chiefly British, one of two or more persons sharing the same flatFLOOR: the occupants of a floor, a structure dividing a building into stories (the third floor)HABITABILITY: capable of being lived in: suitable for habitationHABITABLE: capable of being lived in: suitable for habitationHABITATION: a dwelling place; also, the act of inhabiting: occupancy (not fit for human habitation)HACIENDA: a large estate especially in a Spanish-speaking country: a plantation; also, the main dwelling of a haciendaHALL: the castle or house of a medieval king or nobleHAUNT: a place habitually frequentedHAVEN: a place of safety: a refuge; a place offering favorable opportunities or conditionsHIVE: to reside in close associationHIVED: to reside in close associationHIVING: to reside in close associationHOBO: often disparaging: a usually very poor person who has no permanent residence and travels from place to place especially by furtively hopping trains; also, a migrant worker; also, to live or travel in the manner of a hoboHOBOS: often disparaging: a usually very poor person who has no permanent residence and travels from place to place especially by furtively hopping trains; also, a migrant worker; also, to live or travel in the manner of a hoboHOGAN: a Navajo Indian dwelling usually made of logs and mud with a door traditionally facing eastHOME: one's place of residence: a domicile; also, a house; also, a familiar or usual setting: congenial environment; also, the social unit formed by a family living together; also, one’s place of originHOMETOWN: the city or town where one was born or grew up; also: the place of one's principal residenceHOMEY: homelike; evocative of homeHOOCH: or hootch: slang: a usually thatched hut; broadly: a dwellingHOOD: informal: a neighborhood and especially an inner-city neighborhood; short for neighborhoodHOOTCH*: variant of hooch: slang: a usually thatched hut; broadly: a dwellingHUTCH: a shack or shantyIGLOO: a usually dome-shaped dwelling of arctic regions that is usually made of blocks of snow or ice when built for temporary purposes or of sod, wood, or stone when permanent …; also, a building or structure shaped like a domeIMMIGRANT: a person who comes to a country to take up permanent residence IMMIGRATING: to enter and usually become established, especially: to come into a country of which one is not a native for permanent residenceINHABIT: to occupy as a place of settled residence or habitat: to live in; to be present in or occupy in any manner or formINHABITANT: one that occupies a particular place regularly, routinely, or for a period of timeINHABITATION: the act of inhabiting: the state of being inhabitedINHABITING: to occupy as a place of settled residence or habitat: live in; to be present in or occupy in any manner or formINMATE: any of a group occupying a single place of residenceKHAN: a caravansary or rest house in some Asian countriesLIVABILITY: or less commonly liveability; suitability for human living (e.g., of a dwelling)LIVABLE: or less commonly liveable: suitable for living in, on, or with (a livable house)LIVE: to occupy a home: to dwell (live in a small home); to cohabit (they live together)LIVEABLE: or more commonly livable: suitable for living in, on, or with (a livable house)LIVED: to occupy a home: to dwell (live in a small home); to cohabit (they live together)LIVING: to occupy a home: to dwell (live in a small home); to cohabit (they live together)LOCAL: a local person (the locals meet here on Saturday night)LOCATE: to establish oneself or one's business: to settle (the company will locate north of the city)LODGE: a house set apart for residence in a particular season (such as the hunting season); a resort hotel: an inn; a house on an estate originally for the use of a gamekeeper, caretaker, or porter; a shelter for an employee (such as a gatekeeper); also, a wigwam; also (chiefly dialectal) a rude shelter or abode; also, to provide temporary quarters for; to rent lodgings to; to establish or settle in a place; to occupy a place temporarily: to sleep; to have a residence: to dwell; to be a lodgerLODGED: a house set apart for residence in a particular season (such as the hunting season); a resort hotel: an inn; a house on an estate originally for the use of a gamekeeper, caretaker, or porter; a shelter for an employee (such as a gatekeeper); also, a wigwam; also (chiefly dialectal) a rude shelter or abode; also, to provide temporary quarters for; to rent lodgings to; to establish or settle in a place; to occupy a place temporarily: to sleep; to have a residence: to dwell; to be a lodgerLODGING: a house set apart for residence in a particular season (such as the hunting season); a resort hotel: an inn; a house on an estate originally for the use of a gamekeeper, caretaker, or porter; a shelter for an employee (such as a gatekeeper); also, a wigwam; also (chiefly dialectal) a rude shelter or abode; also, to provide temporary quarters for; to rent lodgings to; to establish or settle in a place; to occupy a place temporarily: to sleep; to have a residence: to dwell; to be a lodgerLONELY: not frequented by human beings: desolate (a lonely spot in the woods)MANOR: the house or hall of an estate: a mansion; also, a landed estate; also, a tract of land in North America occupied by tenants who pay a fixed rent in money or kind to the proprietorMANORIAL: the house or hall of an estate: a mansion; also, a landed estate; also, a tract of land in North America occupied by tenants who pay a fixed rent in money or kind to the proprietorMIGRANT: an immigrant, especially: a refugee; also, someone that migrates: such as a person who moves regularly in order to find work especially in harvesting cropsMIGRATING: [of people] to move from one country, place, or locality to anotherMOBILE: migratory (a mobile society of nomadic herders) [people, not animals]MOVE: a change of residence or location; also, to change one's residence or location (decided to move to the city) MOVED: a change of residence or location; also, to change one's residence or location (decided to move to the city)NOMAD: a member of a people who have no fixed residence but move from place to place usually seasonally and within a well-defined territoryNOMADIC: of, relating to, or characteristic of nomads, a member of a people who have no fixed residence but move from place to place usually seasonally and within a well-defined territoryOCCUPANT: one who occupies a particular place especially, a residentOPEN: sparsely distributed: scattered (open population)PALACE: a large stately house; the official residence of a chief of state (such as a monarch or a president); also, (adj.) of or relating to a palace; also, (adj.) of, relating to, or involving the intimates of a chief executive (palace politics); from Middle English palais, from Anglo-French, from Latin palatium, from Palatium, the Palatine Hill in Rome where the emperors' residences were builtPALAPA: not in M-W but in NOAD, and Collins has “(esp. in Mexico) a simple, thatched-roof dwelling, usually open on the sides; also, any building resembling this, esp. in a resort area, as a restaurant, beachhouse, or the like”PALATIAL: of, relating to, or being a palace (a palatial home); also, suitable to a palace: magnificent (palatial furnishings) ; from Palatium, the Palatine Hill in Rome where the emperors' residences were builtPARADOR* : a usually government-operated hostelry found especially in SpainPEOPLE: to dwell in: to inhabitPIGPEN: a dirty slovenly placePLACE: a building, part of a building, or area occupied as a home (our summer place; come over to my place); also, an available seat or accommodation (he needs a place to stay); also, to find a place (such as a home) forRACK: to raise (rents) oppressively; to harass or oppress with high rents or extortionsRAMADA: Southwestern US: a roofed shelter with usually open sidesRANCH: a ranch house; also to live or work on a ranchRANCHING: a ranch house; also to live or work on a ranchROOF: the roof of a dwelling conventionally designating the home itself (living under my roof)ROOM: to occupy or share a room especially as a lodger; also, to accommodate with lodgingsROOMING: to occupy or share a room especially as a lodger; also, to accommodate with lodgingsROOT: a special or close relationship with an environment —used with in (she has roots in the community)TEEPEE: variant spelling of tepee: a conical tent usually consisting of skins and used especially by Indigenous peoples of the Great PlainsTELL: hill, mound, specifically: an ancient mound in the Middle East composed of remains of successive settlementsTENEMENT: a house used as a dwelling: a residence; a dwellingTENT: a dwelling; also, to reside for the time being: to lodgeTENTED: a dwelling; also, to reside for the time being: to lodgeTENTING: a dwelling; also, to reside for the time being: to lodgeTEPEE: or teepee or tipi: a conical tent usually consisting of skins and used especially by Indigenous peoples of the Great PlainsTIPI: less common spelling of tepee: a conical tent usually consisting of skins and used especially by Indigenous peoples of the Great PlainsTOWNHOME: US: a house that has two or three levels and that is attached to a similar house by a shared wall: a town house, a usually single-family house of two or sometimes three stories that is usually connected to a similar house by a common sidewallTURF: a frequently or habitually visited place: stomping groundUNIT: one of a number of apartment or residences in a building or complex (they rented a unit on the seventh floor)UPROOT: to displace from a country or traditional habitat (Taking the job would mean uprooting my family.)VAGABOND: a person who wanders from place to place without a fixed home: one leading a vagabond life, especially: a vagrant, a tramp; (adj) moving from place to place without a fixed home: wandering; of, relating to, or characteristic of a wanderer; also, to wander in the manner of a vagabond: to roam about; leading an unsettled, irresponsible, or disreputable lifeVAGRANT: usually disparaging: someone who has no established residence and wanders idly from place to place without lawful or visible means of support; also, someone whose conduct constitutes vagrancy under state statute or other applicable law or regulation; (adj) wandering about from place to place usually with no means of support; a wanderer, a roverVILLA: a country estate; also, the rural or suburban residence of a wealthy personWAVE: one of a succession of influxes of people migrating into a region; also, a sudden rapid increase in a populationWIGWAM: a hut used by Indigenous American peoples of the Great Lakes region and eastward having typically an arched framework of poles overlaid with bark, mats, or hides; also: a rough hutWORLD: the earth with its inhabitants and all things upon it; of or relating to the world; extending or found throughout the world: worldwide (world peace); involving or applying to part of or the whole world (a world tour)YURT: a circular domed tent of skins or felt stretched over a collapsible lattice framework and used by pastoral peoples of inner Asia; also: a structure that resembles a yurt usually in size and design
ABOUT THE LEXITOPICS PROJECT
Spelling Bee Words Related to PEOPLE: INDIVIDUALS AND GROUPS
ABEDABOARDABODEACCOMPANYACQUAINTACTIONADMANADOPTADOPTEDADOPTEEADOPTIONADULTADWOMENAFFAIRAFFIANCEAFFIANCINGAFFILIATEAFFILIATINGAFFINITYAGEDAGEINGAGINGAKINALIENATEALLEGIANCEALLIANCEALLIEDALLYALLYINGALONEALONGALOOFALOOFLYALTARALUMNAALUMNAEALUMNIAMATORYAMAZONAMITYAMONGAMOURANATHEMAANCHORMANANCIENTANIMAANYONEAPARTAPEMANAPEMENARCHRIVALARDORARMYATOMIZATIONATTACHATTACHMENTATTENDATTENDEDATTENTIVEAUNTAUNTYAUTUMNAUTUMNALAVOIDAXMANBABEBABIEDBABYBABYPROOFBACKYARDBAGGAGEBAGMANBAGMENBALLBOYBAMBINO*BANGBANGEDBANGINGBANNEDBANNINGBARBARICBARMAIDBARMANBARRACKBARRINGBARROWBATBOYBATTLEAXBATTLEAXEBAWDBEAUBEDFELLOWBEGATBEGETTINGBEGOTBELLBOYBELLEBELLMANBELLMENBIDDYBIOLOGICALBIRACIALBIRDBIRTHBITCH*BLACKBLACKBALLBLOCBLOCKBLOCKSBLOCSBLOKEBLONDBLONDEBLOODBLUEBOATMANBODYBOINKBOLTBONDBONDINGBONEBONEDBOOSBOOTIEBOOTYBOWMENBOYHOODBRANCHBRIDALBROADBROODBROWNBUBBABUBBLEBUCKBUDDYBULLYBUNDLINGBUNNYBURYBUTCHCABANACABINCADETCALLOWCAMECANOPICCARNALCARNALLYCARRYCARRYINGCATACOMBCATCHCATTLECELIBACYCELIBATECELLCHAIRCHAIRMANCHALETCHAPCHARRO*CHATEAUCHATEAUXCHATTELCHEATCHICKCHICKENCHIEFCHIEFLYCHILDCHILDHOODCHILDLIKECHITCHOIRBOYCHOIRGIRLCHUMCIRCUITCIVILIANCLAIMCLANCLAVECLEAVECLEFTCLICKCLICKEDCLICKINGCLINGCLINGINGCLOAKCLUBCLUBBEDCLUBBYCLUNGCOACHMANCOEDCOFFINCOFFINEDCOFFININGCOGNATECOHORTCOITALCOLLABORATORCOLLEENCOLONELCOLONYCOLONYCOLORCOLOUR*COMECOMINGCOMMITMENTCOMMITTALCOMPANIONCOMPANYCOMPLEXCOMPOUNDCONCORDCONCORDANTCONDOCONDOMCONDOMINIUMCONKCONKEDCONKINGCONNECTCONNECTEDCONNECTIONCONTINENCECONTRACTCOTENANTCOTTAGECOUPLECOUPLEDCOURTCOWGIRLCOWHANDCOYLYCRAMCRAZILYCRAZYCROAKCRONYCRYPTCURTAINCUTEYCUTIECZARCZARINADACHADADDYDAIRYMAIDDALLIEDDALLYDALLYINGDAMEDANDYDANGLEDANGLEDDANGLINGDATEDATEDDATINGDEADDECEDENTDEMIMONDEDEMODEPENDDEPENDEDDEPENDENTDEPENDINGDIDDLEDIDDLEDDIDDLINGDILDODINKDIRTDIRTYDITZDIVADOCTORDOLLDOMICILEDOOMDOOMEDDOOMINGDOORMANDORMDORMITORYDOVEDOWDYDOYENDOYENNEDRABDRAGDROPDROPOUTDROPPINGDUCKDUDEDUMPDUMPEDDWELLDWELLEDDWELLINGDWELTDYADEASYEJECTEJECTABLEEJECTEDEJECTIONELECTELOPEEMBALMEMINENCEEMPTYENATE*ENBYENEMYENGAGEENGAGEDENGAGEMENTENGAGINGENMITYENTICEENTICEDENTICEMENTENTICINGENTOMBENTOMBEDENTOMBMENTEPITAPHETHNICETHNICITYEUNUCHEVICTEVICTEDEVICTEEEVICTIONEXCELLENCEEXCELLENCYEXPELEXPELLEEFAMILIALFAMILIARFAMILIARLYFAMILYFAVORFELLAFELLATEFELLATEDFELLOWFEMALEFEMININEFEMININITYFEMMEFIANCEFIANCEEFILIALFILIALLYFILLYFINDFINDINGFLAMEFLATMATEFLEDGEFLEDGEDFLEDGINGFLINGFLINGINGFLIRTFLIRTYFLOATFLOORFLORIDFLORIDLYFOLKFONDLINGFOOTIEFOOTMAN*FOUNDFRATFRATTYFRUITFULLGAGMAN*GAGMEN*GALLANTGALLANTRYGAMINGAMINEGAMYGANGGAVEGAYDARGENEALOGYGENTGENTLEMANGENTLEMENGHETTOGIGOLOGILLGIRLGIRLHOODGIRLYGIVEGIVENGIVINGGOATGOINGGONEGOONGORGONGRAMGRAMMAGRAMPGRAMPAGRANGRANDADGRANDADDYGRANDBABYGRANDDADGRANDDADDYGRANDPAGRANDPAPAGRANDPOPGRANNYGROOMGROUPGROUPINGGROWNUPGUARDIANGUILDGUNMANGUNMENHABITABILITYHABITABLEHABITATIONHACIENDAHALLHANDHANDLEHANGMANHARPYHARRIDANHAUNTHAVEHAVENHEADHELLCATHENCHMANHENCHMENHEPTATHLETEHEYDAYHIDDENHIDEHIDINGHITCHHITCHEDHITCHINGHITMENHIVEHIVEDHIVINGHOBNOBHOBNOBBY*HOBOHOBOSHOGANHOMEHOMETOWNHOMEYHOMOGAMYHONEYHONEYBUNHONEYMOONHONEYMOONEDHONORANDHONORARYHONORIFICHOOCHHOODHOOKHOOTCH*HORNYHUBBYHUDDLEHUDDLEDHUMANHUNKHUTCH
ICEMANICEMENIGLOOIMMATURITYIMMIGRANTIMMIGRATINGIMMORTALIMPEDIMENTIMPOTENTINCONTINENCEINCONTINENTINDEPENDENCEINDEPENDENTINDIGENEINFANTINFANTILEINFANTILITYINGENUEINHABITINHABITANTINHABITATIONINHABITINGINMATEINNOCENCEINTENTIONINTIMACYINTIMATEINURNINURNINGINVOLVEIRONMANITCHITEMJACKJADEJAYBIRDJOINJOINEDJOININGJOINTJUNTAJUVENILEKEENKEENEDKEENINGKHANKIDDIEKIDDOKIDDYKINKKINKILYKINKYKITHKNOTLADDIELADYLAIDLAINLAITYLANDLADYLANDLORDLATCHLATELAYINGLAYMANLAYMENLAYWOMANLEAGUELEAVELEAVELECHLEFTLEGACYLEGATELEGATEELEGIONLEGITIMIZELETCH*LEWDLIBIDINALLIBIDOLIFELIFELONGLIFETIMELIGHTLIMBLINELINEAGELINEALLINEALLYLITTLELIVABILITYLIVABLELIVELIVEABLELIVEDLIVINGLOCALLOCATELODGELODGEDLODGINGLONELONELYLORDLOVELOVEDLOVELORNLOVELYLOVERLOVINGLYINGMACHINEMADAMMADAMEMADEMAFIAMAHATMAMAIDMAILMANMAILMENMAINLINEMAINTAINMAINTAININGMAJORMAKEMAKINGMALEMALEMAMAMAMMAMAMMY*MANHOODMANLYMANORMANORIALMARITALMARITALLYMARMMAROONMARRYMATCHMATCHEDMATCHMAKEMATEMATEDMATEYMATINGMATRIARCHMATRONMATURITYMENAGE*MENFOLKMIGRANTMIGRATINGMILLENNIALMILLIONMINGLEMINGLEDMINGLINGMINORMINORITYMINXMIXEDMOBILEMOLLMOMMAMOMMYMONOGAMYMONUMENTMOPPETMORTALMOUNDMOUNTMOURNMOURNINGMOUTHMOVEMOVEDMUMMIFIEDMUMMYMUTUALNAILNAILINGNAMENANANANNIEDNANNYNANNYINGNATALITYNATURALNECKNECKEDNECKINGNEONATALNEONATENEPHEWNIECENOBODYNOMADNOMADICNONENUBILENUPTIALOBITOCCUPANTOGLEOGLEDOGLINGOLDIEONCEONLYOPENORBITORGYORIGINORPHANORPHANHOODOUTEDOUTFITOUTINGOUTLAWPACKPAIRPAIRINGPALACEPALAPAPALATIALPALLPALLEDPALLINGPANDITPANTHEONPAPAPAPPYPARADOR* PARAMOURPARIAHPARTPARTICIPANTPARTOOKPARTYPATHPATROLPAWINGPEATPEONPEOPLEPETTEDPIECEPIGPENPILEPILLPILLEDPILLINGPIMPPIMPEDPIMPINGPINNEDPINNINGPIXIEPLACEPLATPLATOONPLAYPLAYBOYPLEDGEPLOTPLOTTINGPOCKETPOGROMPOLYGAMYPOLYGLOTPOOLPOOLINGPOPPAPORTIONPORTIONPOUTPOUTEDPRIAPICPRICKPRIVACYPRIVYPUBLICPUBLICLYPUNKPUPPYQUADQUADRATQUEENQUIETQUINTRABBIRACIALRACIALLYRACILYRACKRACYRAIDRAINBOWRAMADARANCHRANCHINGRANDYRANKREVELERRIFTROMPROOFROOMROOMINGROOTROUNDUPROUTROVERRUNNINGSLOBSLOBSTAILTAKETAKENTARTTARTTEAMTEAMEDTEAMMATETEENTEENAGETEENAGEDTEEPEETELLTENEMENTTENTTENTEDTENTINGTEPEETHEETHEMTHEYTHICKTHINETHINGTHOUTHROUGHTHROWAWAYTIEDTIGHTTIGHTLYTIMETIPITITLETITLEDTITLINGTITULARTOMBTOMBOYTOMCATTOOKTORRIDTORRIDITYTOTEMTOWNHOMETOYEDTRACKTRAMPTRIBALTRIBALLYTRICKTRIPTROLLOPTROOPTROTTROTHTRULL*TRULYTURFTURNTUTELAGETUTORTWEENTWINTWINNINGTYINGTYPEUNATTENDEDUNCLEUNDIDUNDOUNDOINGUNDONEUNENGAGEDUNFLEDGEDUNIONUNITUNITEUNITEDUNITINGUNMANUNMANLYUNMANNINGUNWEANEDUNWEDUNWEDDEDUPBRINGINGUPROOTVAGABONDVAGRANTVALEVALENTINEVAMPVARMINTVAULTVEEPVENDETTAVIBRATORVICEVILLAVIRGINVIRILITYVITALVULGARVULGARLYWAHINEWAIFWAKEWAKINGWALKWANTONWARMWATCHWATCHEDWAVEWEANWEANEDWEANINGWEDDEDWEDDINGWEDLOCKWEEDWELLWENCHWENTWHELPWHITEWHITEWHOLEWIDOWWIDOWEDWIDOWHOODWIGHTWIGWAMWILDWILLWILLEDWILLINGWINGMANWINGMENWINNINGWITCHWITHDRAWWITHINWOLFWOMANWOMANHOODWOMANLYWOMENWOOEDWOOINGWORKMANWORKWOMANWORLDWORLDLYYENTAYENTEYIELDYIELDEDYOUNGYOUNGLYYOURYOUTHYOUTHFULYOUTHFULLYYUPPIEYURT
LexiConnexxions New York Times Spelling Bee answers analysis statistics peregrine
If you cite information from LexiConnexxions, please give credit and a link to the relevant page. These reports and analyses are conceived, compiled, designed, and prepared by a human being, not a machine. This website is 100% AI-free; it is conceived, designed, written, and maintained by a human being. Except where noted, all content ©2022-2026 and in perpetuity by LexiConnexxions. All rights reserved. Dissemination, re-use, or duplication by any means, for any purpose whatsoever, is prohibited except by express written permission of LexiConnexxions. This site is not affiliated with The New York Times or with any other sites related to the New York Times Spelling Bee. Contact LexiConnexxions at info // @ // lexiconnexxions.com.