LexiConnexxions
  • Home
    • Contact
  • The Lexicon
    • Bee Words with Histories
    • The Midden: Discontinued Bee Words
    • IN-OUT Words
    • OUT-IN Words
    • IN-OUT-IN Words
    • OUT-IN-OUT Words
    • FLIP-FLOP Words
    • Pangrams with Checkered Histories
    • Pangram Ratios to Word Counts
    • 2025 Annual Summary
    • 2024 Annual Summary
    • 2023 Annual Summary
    • 2026 Jul Summary
    • 2026 Jun Summary
    • 2026 May Summary
    • 2026 Apr Summary
    • 2026 Mar Summary
    • 2026 Feb Summary
    • 2026 Jan Summary
    • 2025 Dec Summary
    • 2025 Nov Summary
    • 2025 Oct Summary
    • 2025 Sep Summary
    • 2025 Aug Summary
    • 2025 Jul Summary
    • 2025 Jun Summary
    • 2025 May Summary
    • 2025 Apr Summary
    • 2025 Mar Summary
    • 2025 Feb Summary
    • 2025 Jan Summary
    • 2024 Dec Summary
    • 2024 Nov Summary
    • 2024 Oct Summary
    • 2024 Sep Summary
    • 2024 Aug Summary
    • 2024 Jul Summary
    • 2024 Jun Summary
    • 2024 May Summary
    • 2024 Apr Summary
    • 2024 Mar Summary
    • 2024 Feb Summary
    • 2024 Jan Summary
    • 2023 Dec Summary
    • 2023 Nov Summary
    • 2023 Oct Summary
    • 2023 Sep Summary
    • 2023 Aug Summary
    • 2023 Jul Summary
  • Reports & Records
    • Bees of Special Interest
    • 2500th Spelling Bee
    • Goofs and Gaffes
    • All Letters in Bee History
    • Bees with Only One Vowel
    • Bees with J Q S X Z
    • Bees with Letter S
    • Bees with I+N+G and/or E+D
    • Center Letters in Bee History
    • Starting Letters Center Letter Only
    • Starting Letters No Center Letter
    • Starting Letters Fewest
    • Starting Letters No Vowels
  • LexiTopics
    • About the LexiTopics Project
    • The LexiTopics Taxonomy
    • Agriculture & Farm Life
    • Animals
    • Astronomy
    • Attire Fashion & Style
    • Aviation & Aircraft
    • Belief Systems
    • Biology
    • Botanicals
    • Buildings Architecture & Construction
    • Business & Commerce
    • Chemistry
    • Colors
    • Conditions & Characteristics
    • Dance
    • Dramatic Arts
    • Economics & Finance
    • Energy Light Sound Heat
    • Engineering
    • Entertainment Hospitality & Service
    • Environment Habitat & Nature
    • Events & Incidents
    • Existence & Change
    • Food & Drink
    • Furnishings & Fitments
    • Games Toys & Play
    • Geology & Geography
    • Government Civics & Politics
    • History & Olden Times
    • Human Anatomy
    • Human Health & Medicine
    • Information & Communication Technologies
    • Intoxicants
    • Knowledge & Information
    • Law Crime & Courts
    • Learning Education & Research
    • Machines Tools & Devices
    • Manufacturing Products & Packaging
    • Mathematics
    • Matter & Materials
    • Measures & Measurements
    • Motions: Actions & Operations
    • Motions: Coming & Going
    • Motions: Movements
    • Music
    • Myth & Magic
    • Nautical & Maritime
    • Numbers
    • Objects & Collections
    • Occupations
    • People: Character & Appearance
    • People: Efforts & Endeavors
    • People: Emotion & Affect
    • People: Engagement & Interaction
    • People: Individuals & Groups
    • People: Movements & Motions
    • People: Thought & Comprehension
    • Physics
    • Places & Spaces
    • Possession Use & Disposal
    • Quantity Extent Size & Degree
    • Shapes & Textures
    • Speech & Verbal Expression
    • Sports & Recreation
    • Textiles Fibers & Needlecrafts
    • Time
    • Transportation & Travel
    • Visual Arts
    • Weapons & Warfare
    • Weather & Climate
    • Words & Language
    • Writing & Publishing
  • WordPlay
    • Etymologies Brand Names
    • Etymologies Eponyms
    • Etymologies Literary & Film References
    • Etymologies Portmanteaux & Blend-Words
    • Etymologies Toponyms
    • Rogues Offensive
    • Spelling Counts Abandoned Accents
    • Spelling Counts Abbreviations etc.
    • Spelling Counts Clipped Words & Phrases
    • Spelling Counts Palindromes
    • Spelling Counts Reductions Contractions
    • Spelling Counts WORDZ
    • Topics Alphabet Soup
    • Topics Chemical Elements
    • Topics ILLIONs TEENs & NTHs
    • Topics OLOGIES
    • Topics Personal Names
    • Topics State Birds
    • Topics Vehicle Makes & Models
    • Solver List ABLE IBLE
    • Solver List AUGH EIGH IGH OUGH
    • Solver List CATS AND DOGS
    • Solver List -EE
    • Solver List -FUL-
    • Solver List NYMs
    • Solver List WOMAN MAN GIRL BOY
    • Solver List WOOD WIND WILD
    • Wanderings GIRD
    • Wanderings JECT
    • Wanderings MOTORWAY
  • Gameplay
    • The Puzzle Page
    • Entering Words in the Puzzle
    • Ranks and Scoring
    • The Official Hints Page
    • Pangrams and Bingo
    • Solv-ING Tips
    • Looking Up Bee Words
    • Navigating the Forum
    • Participating in the Forum
    • Beeatrice
  • Resources
    • Spelling Bee Dictionaries
    • Spelling Bee Info from NYT
    • Spelling Bee Editor
    • Spelling Bee Community
    • NYT Games Info from NYT
    • Spelling Bee in the News
    • Spelling Bee Research & Data
    • Spelling Bee Transcripts

LexiTopic: Motions: Actions and Operations

If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to MOTIONS: ACTIONS AND OPERATIONS in the Spelling Bee lexicon. The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Click HERE to learn more about the LexiTopics analysis project, including origins, methodology, process, and more.
Click HERE to jump to the LexiTopics main page, with links to the dozens of LexiTopics Reports.
Click HERE to see the entire LexiTopics Taxonomy, the subject list that was developed exclusively for this analysis.
Taxonomy for Spelling Bee words related to MOTIONS: ACTIONS AND OPERATIONS
SUBJECT HEADINGS IN THIS LEXITOPIC: Attaching, Affixing general termsBumping, Hitting, Striking not interpersonal Connecting, JoiningCutting, Chopping not cookeryDividing, Separating not mathematics, not peopleGrating, Grinding, Crushing not cookeryLifting, Hoisting, CarryingPoking, Piercing not interpersonalPressing, PinchingPulling, Dragging
NOTES ABOUT THE TAXONOMY FOR MOTIONS: ACTIONS AND OPERATIONS SCOPE NOTE: This LexiTopic compiles and defines Bee words related to actions and operations that (in general) affect or are done to objects, materials, etc. Words related (in general) to proceeding, returning, etc., are in MOTIONS: COMING AND GOING. Words related (in general) to motions (falling, rising, etc.) are in MOTIONS: MOVEMENTS. Words related to human physical motions, especially when they involve other people, are in PEOPLE: MOVEMENTS AND MOTIONS.
Topical arrangement of Spelling Bee words related to MOTIONS: ACTIONS AND OPERATIONS
Attaching, Affixing general terms
ADHIBIT*: to affix, as a labelAFFIX: to attach physicallyAFFIXED: to attach physicallyATTACH: to make fast (as by tying or gluing)ATTACHMENT: the physical connection by which one thing is attached to another; also, the process of physically attachingATTRACT: to cause to approach or adhereATTRACTOR: to cause to approach or adhereBOND: to hold together or solidify by or as if by means of a bond or binder; also, an adhesive, cementing material, or fusible ingredient that combines, unites, or strengthens; also, to cause to adhere firmly (Heat is used to bond the plastic sheets together.)BONDING: to hold together or solidify by or as if by means of a bond or binder; also, an adhesive, cementing material, or fusible ingredient that combines, unites, or strengthens; also, to cause to adhere firmly (Heat is used to bond the plastic sheets together.)CEMENT: a binding element or agency: such as a substance to make objects adhere to each other, or something serving to unite firmly; also, to unite or make firm by or as if by cementCEMENTED: a binding element or agency: such as a substance to make objects adhere to each other, or something serving to unite firmly; also, to unite or make firm by or as if by cementCLAVE: past participle of cleave, to adhere firmly and closely or loyally and unwaveringlyCLEAVE: to adhere firmly and closely or loyally and unwaveringlyCLING: to hold together; to adhere as if glued firmlyCLINGING: to hold together; to adhere as if glued firmlyCLOVEN: past participle of cleave, to adhere firmly and closely or loyally and unwaveringlyCLUNG: past tense and past participle of cling, to hold or hold on tightly or tenaciouslyGLUE: any of various strong adhesive substances, especially: a hard protein chiefly gelatinous substance that absorbs water to form a viscous solution with strong adhesive properties and that is obtained by cooking down collagenous materials (such as hides or bones); a solution of glue used for sticking things together; something that binds together (social glue); also, to cause to stick tightly with or as if with glue (gluing the parts together)GLUED: any of various strong adhesive substances, especially: a hard protein chiefly gelatinous substance that absorbs water to form a viscous solution with strong adhesive properties and that is obtained by cooking down collagenous materials (such as hides or bones); a solution of glue used for sticking things together; something that binds together (social glue); also, to cause to stick tightly with or as if with glue (gluing the parts together)GLUING: any of various strong adhesive substances, especially: a hard protein chiefly gelatinous substance that absorbs water to form a viscous solution with strong adhesive properties and that is obtained by cooking down collagenous materials (such as hides or bones); a solution of glue used for sticking things together; something that binds together (social glue); also, to cause to stick tightly with or as if with glue (gluing the parts together)IMPLANT: to fix or set securely or deeplyINFIX: to fasten or fix by piercing or thrusting inPEGGED: to attach or fix as if with a peg; to put a peg intoPEGGING: to attach or fix as if with a peg; to put a peg intoPINNED: to fasten, join, or secure with a pin (pinned on a brooch)PINNING: to fasten, join, or secure with a pin (pinned on a brooch)UNITE: to cause to adhere (uniting bricks with mortar); to become combined by or as if by adhesion or mixtureUNITED: to cause to adhere (uniting bricks with mortar); to become combined by or as if by adhesion or mixtureUNITING: to cause to adhere (uniting bricks with mortar); to become combined by or as if by adhesion or mixture
Bumping, Hitting, Striking not interpersonal
BANG: a resounding blow; also, to strike sharply, to bump (banged his knee); to knock, hit, or thrust vigorously often with a sharp noise (banged the door shut)BANGED: a resounding blow; also, to strike sharply, to bump (banged his knee); to knock, hit, or thrust vigorously often with a sharp noise (banged the door shut)BANGING: a resounding blow; also, to strike sharply, to bump (banged his knee); to knock, hit, or thrust vigorously often with a sharp noise (banged the door shut)BEAT: to strike repeatedly; to strike directly against forcefully and repeatedly: to dash against; to strike repeatedly so as to inflict painBEATEN: to strike repeatedly; to strike directly against forcefully and repeatedly: to dash against; to strike repeatedly so as to inflict painBELT: a jarring blow: a whack; also, to beat with or as if with a belt: thrash; to strike, hitBELTING: a jarring blow: a whack; also, to beat with or as if with a belt: thrash; to strike, hitBIFF: to whack, to strikeBIFFED: to whack, to strikeBLOW: a forcible or sudden act or effort: assault (at a single blow); a forcible stroke delivered with a part of the body (such as the fist) or with an instrumentBONK: to hit or strikeBOWL: to strike with a swiftly moving object (bowled over by a base runner)BOWLED: to strike with a swiftly moving object (bowled over by a base runner)BOWLING: to strike with a swiftly moving object (bowled over by a base runner)BUFFET: a blow especially with the hand; something that strikes with telling force; also, to strike sharply especially with the hand: to cuff; to strike repeatedly: to batter; to drive, force, move, or attack by or as if by repeated blowsBUMP: a sudden forceful blow, impact, or jolt (felt a bump when the boat hit the dock); also, to strike or knock against something or someone with a sudden forceful thud or jolt —often used with into or against (The boat bumped against the pier.); to strike or knock (something, such as a body part) with sudden force or violence (I fell and bumped my head.); to hit and move or dislodge (someone or something) (Be careful not to bump that vase.)BUMPING: a sudden forceful blow, impact, or jolt (felt a bump when the boat hit the dock); also, to strike or knock against something or someone with a sudden forceful thud or jolt —often used with into or against (The boat bumped against the pier.); to strike or knock (something, such as a body part) with sudden force or violence (I fell and bumped my head.); to hit and move or dislodge (someone or something) (Be careful not to bump that vase.)BUTT: to strike or shove with the head or horns; also, a blow or thrust usually with the head or hornsBUTTED: to strike or shove with the head or hornsBUTTING: to strike or shove with the head or hornsCANE: a rod or stick used for flogging; also, to beat with a caneCANED: to beat with a caneCANING: to beat with a caneCLIP: a sharp blow; also, to hit, to punch; especially: to strike in passingCLIPPED: a sharp blow; also, to hit, to punch; especially: to strike in passingCLOCK: to hit hardCLOCKED: to hit hardCLOUT: a blow especially with the hand; also, to hit forcefullyCLUB: to beat or strike with or as if with a clubCLUBBED: to beat or strike with or as if with a clubCLUNK: to hit something with a clunk; to strike or hit with a clunkCLUNKED: to hit something with a clunk; to strike or hit with a clunkCRACK: to strike with a sharp noise: to rap; also, a sharp resounding blow (gave him a crack on the head)CUFF: a blow with the hand especially when open: a slap; also, to strike especially with or as if with the palm of the hand: to buffetCUFFED: a blow with the hand especially when open: a slap; also, to strike especially with or as if with the palm of the hand: to buffetDING: to strike or knock against (got dinged on the elbow)DINGING: to strike or knock against (got dinged on the elbow)DRUB: to beat severely; also, to drum, stamp; to make a succession of strokes or vibrations that produce sounds like drumbeatsDUMP: slang: to knock down: to beatDUMPED: slang: to knock down: to beatFLAIL: to move, swing, or beat as if wielding a flail; to move, swing, or beat like a flail; to strike with or as if with a flail; to move, swing, or beat as if wielding a flailFLAILING: to move, swing, or beat as if wielding a flail; to move, swing, or beat like a flail; to strike with or as if with a flail; to move, swing, or beat as if wielding a flailFLAP: a stroke with something broad: slap; to beat with or as if with a flapFLAPPING: a stroke with something broad: slap; to beat with or as if with a flapFLAY: to lash, to beat with or as if with a whipFLOG: to beat with or as if with a rod or whipFLOGGING: to beat with or as if with a rod or whipFLOOR: to knock or bring downFLOORING: to knock or bring downHIDE: to give a beating to: to flogHIDING: to give a beating to: to flogHITTABLE: capable of being hitHITTING: to reach with or as if with a sudden blow; to strike a blow; to deliver (something, such as a blow) by action; to apply forcefully or suddenly (hit the brakes)IMPACT: an impinging or striking especially of one body against another; to strike forcefully; also, a forceful contact or onset; also: the impetus communicated in or as if in such a contact; also: to cause to strike forcefully; also, to impinge or make contact especially forcefullyIMPINGE: to strike or dash especially with a sharp collisionIMPINGED: to strike or dash especially with a sharp collisionIMPINGING: to strike or dash especially with a sharp collisionKNOCK: to strike something with a sharp blowKNOCKED: to strike something with a sharp blowKNOCKING: to strike something with a sharp blowLACE: to beat, to lashLACED: to beat, to lashLACING: to beat, to lashLAID: to lay: to beat or strike down with forceLAMMED*: to beat soundly; to strike or thrashLAYING: to lay: to beat or strike down with forceLEVEL: to knock down (leveled him with one punch); to lay level with or as if with the ground: to razeLEVELED: to knock down (leveled him with one punch); to lay level with or as if with the ground: to raze LEVELER: one that levels, to knock down (leveled him with one punch); to lay level with or as if with the ground: to razeLEVELING: to knock down (leveled him with one punch); to lay level with or as if with the ground: to razeLICK: a sharp hit: a blow; also, to strike repeatedly: to thrashLICKED: a sharp hit: a blow; also, to strike repeatedly: to thrashLICKING: a sharp hit: a blow; also, to strike repeatedly: to thrashMOWED: to cause to fall: to knock downMOWING: to cause to fall: to knock downMOWN: to cause to fall: to knock downNAIL: to hit or strike in a forceful manner: to whack (nailed him on the head with a rock)NAILING: to hit or strike in a forceful manner: to whack (nailed him on the head with a rock)NETTLE: to strike or sting with or as if with nettlesNETTLED: to strike or sting with or as if with nettlesPANCAKE: to knock flatPANCAKED: to knock flatPELT: a blow or a whack; also, to strike with a succession of blows or missiles (pelted him with stones); to deliver a succession of blows or missiles; to beat or dash repeatedly against (hailstones pelting the roof); to beat incessantlyPELTED: a blow or a whack; also, to strike with a succession of blows or missiles (pelted him with stones); to deliver a succession of blows or missiles; to beat or dash repeatedly against (hailstones pelting the roof); to beat incessantlyPOMMEL: to pummel (M-W: pummel is alteration of pommel)POPPED: to strike or knock sharply: to hitPOPPING: to strike or knock sharply: to hitPOUND: to strike heavily or repeatedly; to strike heavy repeated blowsPOUNDED: to strike heavily or repeatedly; to strike heavy repeated blowsPUMMEL: to pound, to beat; M-W: alteration of pommelPUMMELED: to pound, to beat; M-W: alteration of pommelRAMMING: to strike with violence: to crash; to strike against violently; to force in by or as if by drivingRAPPING: to strike with a sharp blow; to strike a quick sharp blowRIPPING: to hit sharply (ripped a double to left field)TAGGED: to hit solidlyTAGGING: to hit solidlyTHUD: a blow, a forcible stroke delivered with a part of the body (such as the fist) or with an instrument; also, to move or strike so as to make a thudTHUDDED: a blow, a forcible stroke delivered with a part of the body (such as the fist) or with an instrument; also, to move or strike so as to make a thudTHUMP: a blow or knock with or as if with something blunt or heavy; also: the sound made by such a blow; to pound, knock, whip, or thrash; also, to inflict a thump or to make or move with a thumping soundWALLOP: a powerful blow: punch; to hit with force: sock; to thrash soundly: to lambaste; something resembling a wallop especially in suddenness of forceWELT: a heavy blow; also, to hit hardWELTED: a heavy blow; also, to hit hardWHALE: to lash, to thrash; to strike or hit vigorouslyWHAM: a solid blow; to propel, strike, or beat so as to produce a loud impact; to hit or explode with a loud impactWHIP: a stroke or cut with or as if with a whip; also, to strike with a slender lithe implement (such as a lash or rod) especially as a punishment; to spank, to strike especially on the buttocks with the open hand; to strike as a lash does (rain whipped the pavement); also, to drive or urge on by or as if by using a whipWHIPPING: a severe beating or chastisement; also, a stroke or cut with or as if with a whip; also, to strike with a slender lithe implement (such as a lash or rod) especially as a punishment; to spank, to strike especially on the buttocks with the open hand; to strike as a lash does (rain whipped the pavement); also, to drive or urge on by or as if by using a whipWHOP: a heavy blow: a thump; also, to beat, to strikeWHOPPING: a heavy blow: a thump; also, to beat, to strikeWHUPPING: to administer a beating to especially as punishment; alteration of whipWIPE: a blow, a strikeZING: to hit suddenly: to zapZINGING: to hit suddenly: to zap
Connecting, Joining
CATENATE*: to connect in a series; to linkCONJOIN: to join together (things, such as separate entities) for a common purposeCONJOINED: to join together (things, such as separate entities) for a common purposeCONJOINING: to join together (things, such as separate entities) for a common purposeCONJOINT: united, conjoined; related to, made up of, or carried on by two or more in combination: jointCONNECT: to become joined (two rooms connect by a hallway); to join or fasten together usually by something intervening (highway connects the two towns)CONNECTED: to become joined (two rooms connect by a hallway); to join or fasten together usually by something intervening (highway connects the two towns)CONNECTION: to become joined (two rooms connect by a hallway); to join or fasten together usually by something intervening (highway connects the two towns)COUPLE: something that joins or links two things together; also, to join; to fasten together: to linkCOUPLED: something that joins or links two things together; also, to join; to fasten together: to linkEMBED: to make something an integral part of EMBEDDED: to make something an integral part of JOIN: to put or bring together so as to form a unit; to adjoin (e.g., the two estates join)JOINED: to put or bring together so as to form a unit; to adjoin (e.g., the two estates join)JOINING: to put or bring together so as to form a unit; to adjoin (e.g., the two estates join)JOINT: a place where two things or parts are joined (e.g., a joint between two pieces of timber); an area at which two ends, surfaces, or edges are attached; also, to unite by a joint: fit together; to fit as if by joints (e.g., the stones joint neatly)JOINTED: to unite by a joint: fit together; to fit as if by joints (e.g., the stones joint neatly)KNIT: to link firmly or closely (knitted my hands) or to cause to grow together (time and rest will knit a fractured bone), to grow together KNITTING: to link firmly or closely (knitted my hands) or to cause to grow together (time and rest will knit a fractured bone), to grow togetherLINK: a connecting structure or factor, or something analogous to a link of chain; also, to couple or connect by or as if by a link; to become connected by or as if by a link —often used with up (the band linked up with a new record label) (found a link between smoking and cancer)LINKING: a connecting structure or factor, or something analogous to a link of chain; also, to couple or connect by or as if by a link; to become connected by or as if by a link —often used with up (the band linked up with a new record label) (found a link between smoking and cancer)MARRY: to unite in close and usually permanent relation; to combine, uniteMATE: to join or fit together; to coupleMATED: to join or fit together; to coupleMATING: to join or fit together; to coupleMEET: to come into contact or conjunction with: to join; to form a junction or confluence (There is where the brook meets the river.); to occur together (many graces and many virtues meet in her); to encounter, experience (meet obstacles on the path)MEETING: to come into contact or conjunction with: to join; to form a junction or confluence (There is where the brook meets the river.); to occur together (many graces and many virtues meet in her); to encounter, experience (meet obstacles on the path)PIECE: to repair, renew, or complete by adding pieces: to patch; to join into a whole —often used with togetherPIECED: to repair, renew, or complete by adding pieces: to patch; to join into a whole —often used with togetherTACK: to join or add in a slight or hasty manner —usually used with on or onto (tacked on a hasty ending to the story); to add as a supplement or something extra —usually used with on or onto (tacked fees onto the base price)TACKED: to join or add in a slight or hasty manner —usually used with on or onto (tacked on a hasty ending to the story); to add as a supplement or something extra —usually used with on or onto (tacked fees onto the base price)TACKING: to join or add in a slight or hasty manner —usually used with on or onto (tacked on a hasty ending to the story); to add as a supplement or something extra —usually used with on or onto (tacked fees onto the base price)TAGGED: to attach as an addition: to appendTAGGING: to attach as an addition: to appendTAIL: to tag: to attach as an addition: to append; also, to connect end to endTAILING: to tag: to attach as an addition: to append; also, to connect end to endTIED: to place or establish in relationship: to connect; to make a bond or connection; to become attachedTYING: to place or establish in relationship: to connect; to make a bond or connection; to become attachedUNIFIED: brought together as one; also, to make into a unit or a coherent whole: to uniteUNION: an act or instance of uniting or joining two or more things into one; also, the growing together of severed parts; a unified condition: combination, junction (a gracious union of excellence and strength); something that is made one: something formed by a combining or coalition of parts or members; adjective: of, relating to, dealing with, or constituting a unionUNITE: to put together to form a single unit; to become one or as if one (The sperm and egg unite to form an embryo.) [sic]; to possess (different things, such as qualities) in combination (the book unites biography with adventure)UNITED: made one: combined; also, to put together to form a single unit; to become one or as if one (The sperm and egg unite to form an embryo.) [sic]; to possess (different things, such as qualities) in combination (the book unites biography with adventure)UNITING: to put together to form a single unit; to become one or as if one (The sperm and egg unite to form an embryo.) [sic]; to possess (different things, such as qualities) in combination (the book unites biography with adventure)UNITIVE: characterized by or tending to produce unionWEDDED: an act, process, or instance of joining in close association; also, to unite [things] as if by marriage: such as to place in close or intimate associationWEDDING: an act, process, or instance of joining in close association; also, to unite [things] as if by marriage: such as to place in close or intimate associationWELD: to unite or reunite closely or intimately (architecture that welds the past and the present)WELDED: to unite or reunite closely or intimately (architecture that welds the past and the present)WELDING: to unite or reunite closely or intimately (architecture that welds the past and the present)
Cutting, Chopping not cookery
BOBBED: to cut shorter: to crop (bob a horse's tail)BOBBING: to cut shorter: to crop (bob a horse's tail)BOBS: to cut shorter: to crop (bob a horse's tail)CHOP: a sharp downward blow or stroke; also, a mark made by or as if by chopping; also, to make a quick stroke or repeated strokes with or as if with a sharp instrument (such as an ax); also, a forceful usually slanting blow with or as if with an ax or cleaver; also, to cut as if by chopping (chop prices; a bridge chops the lake in two); to subject to the action of a chopper (chop a beam of light); also, to cut into or sever usually by repeated blows of a sharp instrumentCHOPPING: a sharp downward blow or stroke; also, a mark made by or as if by chopping; also, to make a quick stroke or repeated strokes with or as if with a sharp instrument (such as an ax); also, a forceful usually slanting blow with or as if with an ax or cleaver; also, to cut as if by chopping (chop prices; a bridge chops the lake in two); to subject to the action of a chopper (chop a beam of light); also, to cut into or sever usually by repeated blows of a sharp instrumentCLIP: something that is clipped; also, an act of clipping; also, to cut or cut off with or as if with shears; to clip somethingCLIPPABLE: suited or designed to be cut out of something (such as a newspaper or advertisement) for useCLIPPED: something that is clipped; also, an act of clipping; also, to cut or cut off with or as if with shears; to clip somethingHACK: to cut or sever with repeated irregular or unskillful blows; to cut or shape by or as if by crude or ruthless strokes; also, a tool for that purposeHACKED: to cut or sever with repeated irregular or unskillful blows; to cut or shape by or as if by crude or ruthless strokes; also, a tool for that purposeHEWABLE*: M-W does not have an entry for hewable, meaning able to be hewedHEWED: cut with blows of a heavy cutting instrumentHEWING: cutting with blows of a heavy cutting instrumentHEWN: cut with blows of a heavy cutting instrumentJAGGING: to cut indentations intoKNIFING: to use a knife onLOPPING: to remove superfluous parts from; to eliminate as unnecessary or undesirable —usually used with off; also, to cut from a personMINCE: to cut or chop into very small pieces; to subdivide minutely, especially: to damage by cutting up (The director minced up the play.)MINCED: to cut or chop into very small pieces; to subdivide minutely, especially: to damage by cutting up (The director minced up the play.)MINCING: to cut or chop into very small pieces; to subdivide minutely, especially: to damage by cutting up (The director minced up the play.)NICK: a small notch, groove, or chip; also, to make a nick in: to notch, chipNICKED: a small notch, groove, or chip; also, to make a nick in: to notch, chipNICKING: a small notch, groove, or chip; also, to make a nick in: to notch, chipNOTCH: a V-shaped indentation; also, to cut or make a notch inNOTCHED: a V-shaped indentation; also, to cut or make a notch inPARING: to trim off an outside, excess, or irregular part of; also the act of cutting away an edge or surface; also, something pared offPINK: to pierce, to stab; to perforate in an ornamental pattern; to cut a saw-toothed edge onPINKED: to pierce, to stab; to perforate in an ornamental pattern; to cut a saw-toothed edge onPOLL: to cut off or cut short (a material, such as wool)POLLING: to cut off or cut short (a material, such as wool)PRONG: to stab, pierce, or break up with a pronged deviceRAZING: to scrape, cut, or shave offRIBBON: tatter, shred —usually used in plural (a sheet cut to ribbons); also, to rip to shreds, to divide into ribbonsRIBBONING: tatter, shred —usually used in plural (a sheet cut to ribbons); also, to rip to shreds, to divide into ribbonsRIPPING: to tear or split apart or open; to slash or slit with or as if with a sharp blade; to rend, to become rippedROUT: to gouge out or make a furrow in (something, such as wood or metal)TIPPED: to remove the ends of TIPPING: to remove the ends ofTOMAHAWK: a light ax used as a missile and as a hand weapon especially by North American Indigenous people; also, to cut, strike, or kill with a tomahawkTRIM: something that is trimmed off or cut out; also, to remove by or as if by cutting; to make trim and neat especially by cutting or clipping (trim the hedges); to free of excess or extraneous matter by or as if by cutting (trim a budget)TRIMMING: the act of one who trims; also, the remnants of something that has been trimmed: clipping (tree/grass/hedge trimmings); also, something that is trimmed off or cut out; also, to remove by or as if by cutting; to make trim and neat especially by cutting or clipping (trim the hedges); to free of excess or extraneous matter by or as if by cutting (trim a budget)WHITTLE: to pare or cut off chips from the surface of (wood) with a knife; to shape or form by so paring or cutting; to cut or shape something (such as wood) by or as if by paring it with a knife
Dividing, Separating not mathematics, not people
ATOMIZATION: to divide, fragment (an atomized society); to treat as made up of many discrete unitsCHECK: to crack, split (Drying wood can cause it to check.); to crack, to break; to make checks or chinks: to cause to crack (the sun checks timber)CHECKED: to crack, split (Drying wood can cause it to check.); to crack, to break; to make checks or chinks: to cause to crack (the sun checks timber)CHECKING: to crack, split (Drying wood can cause it to check.); to crack, to break; to make checks or chinks: to cause to crack (the sun checks timber)CLAVE: to divide by or as if by a cutting blow: to split; to penetrate or pass through something by or as if by cuttingCLEAVE: to divide by or as if by a cutting blow: to split; to penetrate or pass through something by or as if by cuttingCLEFT: to divide by or as if by a cutting blow: to split; to penetrate or pass through something by or as if by cuttingCLOVEN: past participle of cleave, to divide by or as if by a cutting blow: to split; to penetrate or pass through something by or as if by cuttingCRACK: to break, split, or snap apartDECOUPLE: to eliminate the interrelationship of: to separateDECOUPLED: to eliminate the interrelationship of: to separateDIVIDE: to separate into portions; also, to separate into two or more parts, areas, or groups (divide the city into wards); to separate into classes, categories, or divisions (divide history into epochs); also, an act of dividing; to cleave or part (a ship dividing the waves); to cause to be separate, distinct, or apart from one another (fields divided by stone walls); also, an act of dividingDIVIDED: to separate into portions; also, to separate into two or more parts, areas, or groups (divide the city into wards); to separate into classes, categories, or divisions (divide history into epochs); also, an act of dividing; to cleave or part (a ship dividing the waves); to cause to be separate, distinct, or apart from one another (fields divided by stone walls); also, an act of dividing; also, separated into parts or piecesDIVIDING: to separate into portions; also, to separate into two or more parts, areas, or groups (divide the city into wards); to separate into classes, categories, or divisions (divide history into epochs); also, an act of dividing; to cleave or part (a ship dividing the waves); to cause to be separate, distinct, or apart from one another (fields divided by stone walls); also, an act of dividingDIVVIED: shortening & alteration from divide: to separate into portions; also, to separate into two or more parts, areas, or groups (divide the city into wards); to separate into classes, categories, or divisions (divide history into epochs); also, an act of dividing; to cleave or part (a ship dividing the waves); to cause to be separate, distinct, or apart from one another (fields divided by stone walls); also, an act of dividingDIVVY: shortening & alteration from divide: to separate into portions; also, to separate into two or more parts, areas, or groups (divide the city into wards); to separate into classes, categories, or divisions (divide history into epochs); also, an act of dividing; to cleave or part (a ship dividing the waves); to cause to be separate, distinct, or apart from one another (fields divided by stone walls); also, an act of dividingPART: to become separated into parts; to divide into parts; to keep separate; to hold apartPEEL: to break away from a group or formation —often used with off (ten starlings peeled off from the larger flock)PEELABLE: able to be peeledPEELED: to break away from a group or formation —often used with off (ten starlings peeled off from the larger flock)PICK: to loosen or pull apart with a sharp point (pick wool)PICKED: to loosen or pull apart with a sharp point (pick wool)RAMIFY: to split up into branches or constituent parts; to separate into divisionsRIFT: to cleave, to divide (hills were rifted by the earthquake)RIFTING: to cleave, to divide (hills were rifted by the earthquake)ROPING: to partition, separate, or divide by a rope (rope off the street)TORN: past participle of tear, to separate parts of or pull apart by force: to rend; also, to separate on being pulled: to rend (this cloth is easily torn); to divide or disrupt by the pull of contrary forces (a mind torn by doubts)UNCONNECTED: not joined, linked together, or related: not connected (two unconnected plots of land) (unconnected events)
Grating, Grinding, Crushing not cookery
ATOMIZATION: to reduce to minute particles or to a fine sprayATTRITION: the act of rubbing together: friction; also: the act of wearing or grinding down by frictionBRAY: to crush or grind fine (bray seeds in a mortar)BRAYING: to crush or grind fine (bray seeds in a mortar)BUTT: to reduce (something, such as a cigarette) to an unused remainder by stubbing or stamping: to reduce to a buttBUTTED: to reduce (something, such as a cigarette) to an unused remainder by stubbing or stamping: to reduce to a buttBUTTING: to reduce (something, such as a cigarette) to an unused remainder by stubbing or stamping: to reduce to a buttFLAKE: to form or break into flakes:; to chip; to separate into flakes; also: to peel in flakesFLAKED: to form or break into flakes:; to chip; to separate into flakes; also: to peel in flakesFLAKING: to form or break into flakes:; to chip; to separate into flakes; also: to peel in flakesGALL: to fret and wear away by friction: to chafe (the loose saddle galled the horse's back) (the galling of a metal bearing)GALLED: to fret and wear away by friction: to chafe (the loose saddle galled the horse's back) (the galling of a metal bearing)GALLING: to fret and wear away by friction: to chafe (the loose saddle galled the horse's back) (the galling of a metal bearing)GRIND: to reduce to powder or small fragments by friction (as in a mill or with the teeth); to press together with a rotating motion (grind the teeth); to rub or press harshly (ground the cigarette out); to wear down, polish, or sharpen by friction; to operate or produce by turning a crank (grind a hand organ); to move with difficulty or friction especially so as to make a grating noise (gears grinding)GRIND: to reduce to powder or small fragments by friction (as in a mill or with the teeth); to press together with a rotating motion (grind the teeth); to rub or press harshly (ground the cigarette out); to wear down, polish, or sharpen by friction; to operate or produce by turning a crank (grind a hand organ); to move with difficulty or friction especially so as to make a grating noise (gears grinding)GRINDING: to reduce to powder or small fragments by friction (as in a mill or with the teeth); to press together with a rotating motion (grind the teeth); to rub or press harshly (ground the cigarette out); to wear down, polish, or sharpen by friction; to operate or produce by turning a crank (grind a hand organ); to move with difficulty or friction especially so as to make a grating noise (gears grinding)GROUND: to reduce to powder or small fragments by friction (as in a mill or with the teeth); to press together with a rotating motion (grind the teeth); to rub or press harshly (ground the cigarette out); to wear down, polish, or sharpen by friction; to operate or produce by turning a crank (grind a hand organ); to move with difficulty or friction especially so as to make a grating noise (gears grinding)KIBBLE: to grind coarselyMILL: a device or machine for reducing something (as by crushing or grinding) to small pieces or particles (a pepper mill); to crush or grindMILLED: a device or machine for reducing something (as by crushing or grinding) to small pieces or particles (a pepper mill); to crush or grindMILLING: a device or machine for reducing something (as by crushing or grinding) to small pieces or particles (a pepper mill); to crush or grindMULL: to grind or mix thoroughly: to pulverizeMULLED: to grind or mix thoroughly: to pulverizeMULLING: to grind or mix thoroughly: to pulverizePOUND: to reduce to powder or pulp by beatingPOUNDED: to reduce to powder or pulp by beatingRUBBING: to move along the surface of a body with pressure: to grate; to fret or chafe with or as if with friction; to subject to or as if to the action of something moving especially back and forth with pressure and friction; to cause (a body) to move with pressure and friction along a surface; to treat in any of various ways by rubbing; to bring into reciprocal back-and-forth or rotary contact (rubbed two sticks together to start a fire)UNGROUND: not reduced to powder or small fragments: not ground (unground coffee/wheat)
Lifting, Hoisting, Carrying
BRING: to convey or carry, or cause to come along with one toward the place from which the action is being regarded (brought a bottle of wine to the party)BRINGING: to convey or carry, or cause to come along with one toward the place from which the action is being regarded (brought a bottle of wine to the party)BROUGHT: to convey or carry, or cause to come along with one toward the place from which the action is being regarded (brought a bottle of wine to the party)CLOG: an encumbrance or burdenCRANING: to raise or lift by or as if by a crane EASE: to maneuver gently or carefully (eased himself into the chair)EASES: to maneuver gently or carefully (eased himself into the chair)ELEVATE: to lift up or make higher: to raiseELEVATED: to lift up or make higher: to raiseHEAVE: an effort to pull or raise somethingHEFT: to heave up: to hoist JACK: to move or lift (something) by or as if by a jack: to jack upLADED: to put a load or burden on or in; to take on cargo; to load; to load heavily or oppressivelyLADEN: (adj.) carrying a large load or burden: heavily or abundantly loaded; full; also, (verb) to lade (heavily ladened with equipment)LADING: (noun) loading: a cargo, weight, or stress placed on something; also, to put a load or burden on or in; to take on cargo; to load; to load heavily or oppressivelyLIFT: to raise from a lower to a higher position: to elevate; also, the action or an instance of liftingLIFTING: to raise from a lower to a higher position: to elevate; also, the action or an instance of liftingLOAD: whatever is put on a person or pack animal to be carried: a pack (donkeys with heavy loads); also, t to put a load in or on (a vehicle, animal, etc.)LOADED: whatever is put on a person or pack animal to be carried: a pack (donkeys with heavy loads); also, t to put a load in or on (a vehicle, animal, etc.)LOADING: whatever is put on a person or pack animal to be carried: a pack (donkeys with heavy loads); also, t to put a load in or on (a vehicle, animal, etc.)LUGGED: to carry laboriously (lugged the bags to the car)LUGGING: to carry laboriously (lugged the bags to the car)RAPPING: to snatch away or upwardRAPT: lifted up and carried awayRAPTLY: lifted up and carried awayRIDING: to travel as if on a vehicle or other conveyance: to be borne; to carry, to convey (rode the youngster on her back)TOTE: a burden, load; also, to carry by hand: to bear on the person: to lug, packTOTED: to carry by hand: to bear on the person: to lug, packTOTING: to carry by hand: to bear on the person: to lug, packTRAIL: to carry or bring along as an addition, burden, or encumbranceTUGGED: to carry with difficulty: to lugTUGGING: to carry with difficulty: to lugUNLADE*: to take the load or cargo from; to discharge, unload; to discharge cargoUNLADED*: to take the load or cargo from; to discharge, unload; to discharge cargoUNLADEN: to take the load or cargo from; to discharge, unload; to discharge cargoUPHEAVE: to heave up: lift; to move upward especially with powerUPPED: to raise, to liftUPPING: to raise, to lift
Poking, Piercing not interpersonal
GOAD: something that pains as if by pricking: a thorn; also, to prick with a goadGOADED: something that pains as if by pricking: a thorn; also, to prick with a goadGOADING: something that pains as if by pricking: a thorn; also, to prick with a goadIMPALE: to pierce with or as if with something pointed; especially: to torture or kill by fixing on a sharp stakeLANCE: to pierce with or as if with a lanceLANCED: to pierce with or as if with a lanceLANCING: to pierce with or as if with a lancePECK: a quick sharp stroke; also, to strike or pierce especially repeatedly with the bill or a pointed tool; to make by pecking (peck a hole); also, an impression or hole made by peckingPECKED: a quick sharp stroke; also, to strike or pierce especially repeatedly with the bill or a pointed tool; to make by pecking (peck a hole); also, an impression or hole made by peckingPICK: a blow or stroke with a pointed instrument; also, to pierce, penetrate, or break up with a pointed instrument; to remove bit by bit (pick meat from bones); to remove covering or adhering matter from (pick the bones); PICKED: a blow or stroke with a pointed instrument; also, to pierce, penetrate, or break up with a pointed instrument; to remove bit by bit (pick meat from bones); to remove covering or adhering matter from (pick the bones); PINK: to pierce, to stab; to perforate in an ornamental pattern; to cut a saw-toothed edge onPINKED: to pierce, to stab; to perforate in an ornamental pattern; to cut a saw-toothed edge onPOKE: to pierce, stab; also, to produce by or as if by piercing, stabbing, or jabbing (poke a hole)PROD: a pointed instrument used to prod; also, to poke or stir as if with a prod; to thrust a pointed instrument into: to prickPRODDING: a pointed instrument used to prod; also, to poke or stir as if with a prod; to thrust a pointed instrument into: to prickRIFT: to penetrateRIFTING: to penetrateRUNNING: to cause to penetrate or enter: to thrust (ran a splinter into her toe)TORN: past participle of tear, to make (a hole or opening) by or as if by pulling apart by force (tear a hole in the wall); also, to smash or penetrate something with violent force (the bullet tore through his leg)
Pressing, Pinching
CHAMP: to mashCRIMP: to pinch or press together (something, such as the margins of a pie crust) in order to sealCRIMPING: to pinch or press together (something, such as the margins of a pie crust) in order to sealCRUNCH: to chew or press with a crushing noise; to chew, press, or grind with a crunching sound EASE: to lessen the pressure or tension of especially by slackening, lifting, or shifting (ease a spring); to apply less pressure —usually used with up or off (ease up on the accelerator)EASES: to lessen the pressure or tension of especially by slackening, lifting, or shifting (ease a spring); to apply less pressure —usually used with up or off (ease up on the accelerator)IMPACT: to press together; to fix firmly by or as if by packing or wedgingJAMMING: to cause (a part of the body) to be painfully crushed or squeezed (jammed his finger in the door)NIPPED: to pinch; to catch hold of and squeeze tightly between two surfaces, edges, or pointsNIPPING: to pinch; to catch hold of and squeeze tightly between two surfaces, edges, or pointsPINCH: to press painfully; to squeeze or compress painfully; an act of pinching: a squeeze; also, to squeeze between the finger and thumb or between the jaws of an instrument; also, to squeeze or compress painfully; to restrain or limit narrowly: to constrict; to narrow, taper; to compress, to squeezePINCHING: to press painfully; to squeeze or compress painfully; an act of pinching: a squeeze; also, to squeeze between the finger and thumb or between the jaws of an instrument; also, to squeeze or compress painfully; to restrain or limit narrowly: to constrict; to narrow, taper; to compress, to squeezePRINT: a mark made by pressure: an impression; also, a fingerprint: the impression of a fingertip on any surface; also, something impressed with a print or formed in a mold; also, to impress something in or on; to stamp (something, such as a mark) in or on somethingTAMP: a tamper, a tool for tamping; also, to tamp, to drive in or down by a succession of light or medium blows (tamp wet concrete)
Pulling, Dragging
BUDGING: to move, shift (the mule wouldn't budge); to cause to move or change (I can’t budge this sofa.)DRAFT: the act of moving loads by drawing or pulling: pullDRAG: something used to drag with, especially: a device for dragging under water to detect or obtain objects; also, to explore with a drag (drag the pond for the drowning victim); to pass a drag over (drag a field); something that is dragged, pulled, or drawn along or over a surface; also, to cause to trail along a surface (wandered off dragging the leash); to trail along on the ground (Your scarf is dragging.); a drawing along or over a surface with effort or pressure; to draw or pull slowly or heavily: to haul; to bring by or as if by force or compulsion (dragging the kids to the grocery store); to extract by or as if by pulling (drag the truth out of him); to make a plucking or pulling movementDRAGGING: something used to drag with, especially: a device for dragging under water to detect or obtain objects; also, to explore with a drag (drag the pond for the drowning victim); to pass a drag over (drag a field); something that is dragged, pulled, or drawn along or over a surface; also, to cause to trail along a surface (wandered off dragging the leash); to trail along on the ground (Your scarf is dragging.); a drawing along or over a surface with effort or pressure; to draw or pull slowly or heavily: to haul; to bring by or as if by force or compulsion (dragging the kids to the grocery store); to extract by or as if by pulling (drag the truth out of him); to make a plucking or pulling movementHALE: to haul or pullHEAVE: an effort to pull or raise something; also, an upward motion: rising, especially: a rhythmical rising (the heave of his chest)LUGGED: to drag, to pull; to pull with effort: to tugLUGGING: to drag, to pull; to pull with effort: to tugPLUCK: to pull or pick off or out; to make a sharp pull or twitch; to pick, pull, or grasp at; also, an act or instance of plucking or pullingPULL: the act or an instance of pulling; also, to exert force upon so as to cause or tend to cause motion toward the force; also, to use force in drawing, dragging, or tugging; also, to move, especially through the exercise of mechanical energy (the car pulled clear of the rut)PULLBACK: a pulling backPULLOUT: pullback; the act or an instance of pulling out; also, something that can be pulled outRACK: the action of straining or wrenching; also, to stretch or strain violentlyROOT: to remove altogether by or as if by pulling out by the roots —usually used with out (root out dissenters)ROUT: to cause to emerge especially from bedTORN: past participle of tear, to remove by force: to wrench —often used with off (tear a cover off a box); also, to remove as if by wrenching (tear your thoughts away from the scene)TOWED: to draw or pull along behind: to haul (tow a wagon); also, to move in towTOWING: to draw or pull along behind: to haul (tow a wagon); also, to move in towTRAIL: to draw or drag loosely along a surface: to allow to sweep the ground; to haul, tow; TRAIN: to trail, to dragTUGGED: to pull hard; to pull or strain hard or forcefully at; to move by pulling hard: to haulTUGGING: to pull hard; to pull or strain hard or forcefully at; to move by pulling hard: to haulTWITCH: an act of twitching, especially: a short sudden pull or jerk; also, to pull, to pluck; to move or pull with a sudden motion: to jerkTWITCHED: an act of twitching, especially: a short sudden pull or jerk; also, to pull, to pluck; to move or pull with a sudden motion: to jerkTWITCHING: an act of twitching, especially: a short sudden pull or jerk; also, to pull, to pluck; to move or pull with a sudden motion: to jerkYANK: a strong sudden pull: a jerk; also, to pull on something with a quick vigorous movement; to pull or extract with a quick vigorous movement; to remove in or as if in an abrupt mannerYANKING: a strong sudden pull: a jerk; also, to pull on something with a quick vigorous movement; to pull or extract with a quick vigorous movement; to remove in or as if in an abrupt manner
Spelling Bee words related to MOTIONS: ACTIONS AND OPERATIONS
ADHIBIT*AFFIXAFFIXEDATOMIZATIONATTACHATTACHMENTATTRACTATTRACTORATTRITIONBANG BANGEDBANGINGBEATBEATENBELTBELTINGBIFFBIFFEDBLOWBOBBEDBOBBINGBOBSBONDBONDINGBONKBOWLBOWLEDBOWLINGBRAYBRAYINGBRINGBRINGINGBROUGHTBUDGINGBUFFETBUMPBUMPINGBUTTBUTTEDBUTTINGCANECANEDCANINGCATENATE*CEMENTCEMENTEDCHAMPCHECKCHECKEDCHECKINGCHOPCHOPPINGCLAVECLEAVECLEFTCLINGCLINGINGCLIPCLIPPABLECLIPPEDCLOCKCLOCKEDCLOGCLOUTCLOVENCLUBCLUBBEDCLUNGCLUNKCLUNKEDCONJOINCONJOINEDCONJOININGCONJOINTCONNECTCONNECTEDCONNECTIONCOUPLECOUPLEDCRACKCRANINGCRIMPCRIMPINGCRUNCHCUFFCUFFEDDECOUPLEDECOUPLEDDINGDINGINGDIVIDEDIVIDEDDIVIDINGDIVVIEDDIVVYDRAFTDRAGDRAGGINGDRUBDUMPDUMPEDEASEEASESELEVATEELEVATEDEMBEDEMBEDDEDFLAILFLAILINGFLAKEFLAKEDFLAKINGFLAPFLAPPINGFLAYFLOGFLOGGINGFLOORFLOORINGGALLGALLEDGALLINGGLUEGLUEDGLUINGGOADGOADEDGOADINGGRINDGRINDINGGROUNDHACKHACKEDHALEHEAVEHEFTHEWABLE*HEWEDHEWINGHEWNHIDEHIDINGHITTABLEHITTINGIMPACTIMPALEIMPINGEIMPINGEDIMPINGINGIMPLANTINFIXJACKJAGGINGJAMMINGJOINJOINEDJOININGJOINTJOINTEDKIBBLEKNIFINGKNITKNITTINGKNOCKKNOCKEDKNOCKINGLACELACEDLACINGLADEDLADENLADINGLAIDLAMMED*LANCELANCEDLANCINGLAYING
LEVELLEVELED LEVELERLEVELINGLICKLICKEDLICKINGLIFTLIFTINGLINKLINKINGLOADLOADEDLOADINGLOPPINGLUGGEDLUGGINGMARRYMATEMATEDMATINGMEETMEETINGMILLMILLEDMILLINGMINCEMINCEDMINCINGMOWEDMOWINGMOWNMULLMULLEDMULLINGNAILNAILINGNETTLENETTLEDNICKNICKEDNICKINGNIPPEDNIPPINGNOTCHNOTCHEDPANCAKEPANCAKEDPARINGPARTPECKPECKEDPEELPEELABLEPEELEDPEGGEDPEGGINGPELTPELTEDPICKPICKEDPIECEPIECEDPINCHPINCHINGPINKPINKEDPINNEDPINNINGPLUCKPOKEPOLLPOLLINGPOMMELPOPPEDPOPPINGPOUNDPOUNDEDPRINTPRODPRODDINGPRONGPULLPULLBACKPULLOUTPUMMELPUMMELEDRACKRAMIFYRAMMINGRAPPINGRAPTRAPTLYRAZINGRIBBONRIBBONINGRIDINGRIFTRIFTINGRIPPINGROOTROPINGROUTRUBBINGRUNNINGTACKTACKEDTACKINGTAGGEDTAGGINGTAILTAILINGTAMPTHUDTHUDDEDTHUMPTIEDTIPPEDTIPPINGTOMAHAWKTORNTOTETOTEDTOTINGTOWEDTOWINGTRAILTRAINTRIMTRIMMINGTUGGEDTUGGINGTWITCHTWITCHEDTWITCHINGTYINGUNCONNECTEDUNGROUNDUNIFIEDUNIONUNITEUNITEDUNITINGUNITIVEUNLADE*UNLADED*UNLADENUPHEAVEUPPEDUPPINGWALLOPWEDDEDWEDDINGWELDWELDEDWELDINGWELTWELTEDWHALEWHAMWHIPWHIPPINGWHITTLEWHOPWHOPPINGWHUPPINGWIPEYANKYANKINGZINGZINGING
LexiConnexxions New York Times Spelling Bee answers analysis statistics peregrine
If you cite information from LexiConnexxions, please give credit and a link to the relevant page. These reports and analyses are conceived, compiled, designed, and prepared by a human being, not a machine. This website is 100% AI-free; it is conceived, designed, written, and maintained by a human being. Except where noted, all content ©2022-2026 and in perpetuity by LexiConnexxions. All rights reserved. Dissemination, re-use, or duplication by any means, for any purpose whatsoever, is prohibited except by express written permission of LexiConnexxions. This site is not affiliated with The New York Times or with any other sites related to the New York Times Spelling Bee. Contact LexiConnexxions at info // @ // lexiconnexxions.com.

We use cookies only to enable essential functionality on this website. We do not save, analyze, share, rent, or sell this information. By clicking Accept, you consent to our use of cookies. Cookies and Privacy Policy.

Your Cookie Settings

We use cookies to enable essential functionality on our website and analyze website traffic. For more information, read our Cookies and Privacy Policy below..

Cookie Categories
Essential

These cookies are strictly necessary to provide you with services available through our websites.

Analytics

These cookies collect information that is used in aggregate and in an anonymized form to help us understand how our website is being used and how effectively our site is performing.