LexiTopic: Words and Language
If you cite information from this LexiConnexxions report, please give credit and a link to this page. These reports and analyses are compiled and prepared by a human being, not a machine. Thank you.
The LexiConnexxions analysis has identified these words related to WORDS AND LANGUAGE in the Spelling Bee lexicon.
The complete list of words on this topic is shown at right (on laptop or desktop) or at the end of the page (on mobile); the complete topical analysis is given below.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Bee words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
ABOUT THE LEXITOPICS PROJECT
Taxonomy for Spelling Bee words related to WORDS AND LANGUAGE
SUBJECT HEADINGS IN THIS LEXITOPIC:
Alphabets and DiacriticsGrammar, Punctuation, etc.Language and Linguistics not dictionWords about Words
NOTES ABOUT THE TAXONOMY FOR WORDS AND LANGUAGE
SCOPE NOTE: This LexiTopic compiles and defines Bee words related to words and language, including grammar, linguistics, alphabets, and more.
Words related to meaning and expression in speech are in SPEECH AND VERBAL EXPRESSION.
Words related to diction and pronunciation are in SPEECH AND VERBAL EXPRESSION.
Words about literary forms, writing and editing, and publishing are in WRITING AND PUBLISHING.
Topical arrangement of Spelling Bee words related to WORDS AND LANGUAGE
Alphabets and Diacritics
ACCENT: a mark (such as ´, `, ˆ) used in writing or printing to indicate a specific sound value, stress, or pitch, to distinguish words otherwise identically spelled, or to indicate that an ordinarily mute vowel should be pronounced; also, an accented letter; also, to mark with a written or printed accentACUTE: of an accent mark: having the form ´ or marked with an acute accentAITCH*: the letter hALEPH: the 1st letter of the Hebrew alphabetALPHA: the first letter of the Greek alphabet; also, alphabeticALPHABET: a set of letters or other characters with which one or more languages are written especially if arranged in a customary order; also, a system of signs or signals that serve as equivalents for lettersBETA: the second letter of the Greek alphabetCAPITAL: of a letter: of or conforming to the series A, B, C, etc. rather than a, b, c, etc., or a letter belonging to a style of alphabet modeled on the style customarily used in inscriptionsDELTA: the 4th letter of the Greek alphabetDIACRITIC: a mark near or through an orthographic or phonetic character or combination of characters indicating a phonetic value different from that given the unmarked or otherwise marked elementDIACRITICAL: serving as a diacriticDOTTED: a small round mark used in orthography or punctuation (e.g., dot the i)GAMMA: the third letter of the Greek alphabetGLYPH: a symbolic figure or a character (as in the Mayan system of writing) usually incised or carved in reliefGRAPH: a written or printed representation of a basic unit of speech (such as a phoneme or syllable), especially a grapheme; also, a single occurrence of a letter of an alphabet in any of its various shapesGRAPHIC: of or relating to the written or printed word or the symbols or devices used in writing or printing to represent sound or convey meaningHANGUL: often capitalized: the alphabetic script in which Korean is writtenHIRAGANA: the cursive script that is one of two sets of symbols of Japanese syllabic writing; compare katakanaINITIAL: the first letter of a name; initials plural: the first letter of each word in a full nameIOTA: the 9th letter of the Greek alphabetKAPPA: the 10th letter of the Greek alphabet
KAYS: the letter kLOGOGRAM: a letter, symbol, or sign used to represent an entire word (the ampersand and dollar sign are logograms)MACRON: a mark − placed over a vowel to indicate that the vowel is long or placed over a syllable or used alone to indicate a stressed or long syllable in a metrical footMODIFY: to change (a vowel) by umlautOMEGA: the 24th and last letter of the Greek alphabetOMICRON: the 15th letter of the Greek alphabetPOINT: to mark (words, such as Hebrew words) with diacritics (such as vowel points)POINTING: to mark (words, such as Hebrew words) with diacritics (such as vowel points)RABBINIC: or rabbinical, comprising or belonging to any of several sets of Hebrew characters simpler than the square Hebrew lettersRABBINICAL: or rabbinic, comprising or belonging to any of several sets of Hebrew characters simpler than the square Hebrew lettersRUNIC: related to or characteristic of a rune or runes: any of the characters of any of several alphabets used by the Germanic peoples from about the 3rd to the 13th centuriesTHETA: the 8th letter of the Greek alphabetTILDE: a mark ˜ placed especially over the letter n (as in Spanish señor sir) to denote the sound \nʸ\ or over vowels (as in Portuguese irmã sister) to indicate nasalityTITTLE: a point or small sign used as a diacritical mark in writing or printingUMLAUT: a diacritical mark ¨ placed over a vowel to indicate a more central or front articulation; also, to write or print an umlaut overZETA: the 6th letter of the Greek alphabet
Grammar, Punctuation, etc.
ACTIVE: asserting that the person or thing represented by the grammatical subject performs the action represented by the verbADJUNCT: grammar: a word or word group that qualifies or completes the meaning of another word or other words and is not itself a main structural element in its sentenceAFFIX: grammar: one or more sounds or letters occurring as a bound form attached to the beginning or end of a word, base, or phrase or inserted within a word or base and serving to produce a derivative word or an inflectional formANALYZABLE: to subject to grammatical analysisANALYZE: to subject to grammatical analysisANALYZED: to subject to grammatical analysisANALYZING: to subject to grammatical analysisAUGMENT: grammar: a vowel prefixed or a lengthening of the initial vowel to mark past time especially in Greek and Sanskrit verbs; also, to add an augment to (a verb form)AUXILIARY: of a verb: accompanying another verb and typically expressing person, number, mood, or tense; grammar: auxiliary verb, a verb (such as have, be, may, do, shall, will, can, or must) that is used with another verb in a verb phrase to show tense, to form a question, etc.: a helping verbBALANCE: grammar: the juxtaposition in writing of syntactically parallel constructions containing similar or contrasting ideas (such as "to err is human; to forgive, divine")BANG: informal: exclamation pointBLANK: a dash substituting for an omitted wordCOGNATE: of a substantive: related to a verb usually by derivation and serving as its object to reinforce the meaning (such as song in "she sang a song") also, (noun) one that is cognate with anotherCOLON: a punctuation mark; also, the sign: used between the parts of a numerical expression of time or in a bibliographical referenceCOMMA: a punctuation mark, used especially as a mark of separation within the sentenceCOMPLETE: of a subject or predicate: including modifiers, complements, or objectsCOMPLEX: of a word: having a bound form as one or more of its immediate constituents; also, of a sentence: consisting of a main clause and one or more subordinate clausesCOMPOUND: a word consisting of components that are words (such as rowboat, high school, devil-may-care); also, a word (such as anthropology, kilocycle, builder) consisting of any of various combinations of words, combining forms, or affixesCONCORD: grammatical agreementCONTRACT: to shorten (a word) by omitting one or more sounds or letters (Contract "forecastle" to "fo'c'sle.")DANGLE: to occur in a sentence without having a normally expected syntactic relation to the rest of the sentenceDANGLED: to occur in a sentence without having a normally expected syntactic relation to the rest of the sentenceDANGLING: to occur in a sentence without having a normally expected syntactic relation to the rest of the sentenceDATIVE: of, relating to, or being a grammatical case that typically marks the indirect object of a verb, the object of some prepositions, or a person or thing that possesses someone or something elseDECLINE: grammar: to give in prescribed order the grammatical forms of (a noun, pronoun, or adjective) (decline the Latin adjective "brevis")DECLINED: grammar: to give in prescribed order the grammatical forms of (a noun, pronoun, or adjective) (decline the Latin adjective "brevis")DEFINITE: typically designating an identified or immediately identifiable person or thingDEPENDENT: grammar: subordinate (dependent clauses)DIAGONAL: a slash: a mark / used typically to denote "or" (as in and/or), "and or" (as in straggler/deserter), or "per" (as in feet/second); called also diagonal, slant, solidus, virguleDITTO: the inverted commas or apostrophes used to symbolize a dittoDUAL: of grammatical number: denoting reference to two (a dual pronoun)DUALLY: of grammatical number: denoting reference to two (a dual pronoun)ELLIPTIC: of, relating to, or marked by ellipsis or an ellipsis: the omission of one or more words that are obviously understood but that must be supplied to make a construction grammatically complete; also, a sudden leap from one topic to another; also, marks or a mark (such as …) indicating an omission (as of words) or a pause
ELLIPTICAL: variant or elliptic: of, relating to, or marked by ellipsis or an ellipsis: the omission of one or more words that are obviously understood but that must be supplied to make a construction grammatically complete; also, a sudden leap from one topic to another; also, marks or a mark (such as …) indicating an omission (as of words) or a pauseEPICENE: of a noun: having but one form to indicate either sex (e.g., president, violist, sibling)FEMININE: of, relating to, or constituting the gender that ordinarily includes most words or grammatical forms referring to females as well as other words and forms either systematically or arbitrarily in the same categoryFINITE: of, relating to, or being a verb or verb form that can function as a predicate or as the initial element of one and that is limited (as in tense, person, and number)FLAT: grammar: not having an inflectional endingGRAM: abbreviation: grammar; grammaticalGRAMMAR: the study of the classes of words, their inflections, and their functions and relations in the sentenceGRAMMARIAN: one who studies or teaches grammarHEAD: grammar: an immediate constituent of a construction that can have the same grammatical function as the whole (such as man in "an old man," "a very old man," or "the man in the street")HYPHEN: a punctuation mark - used especially to divide or to compound words, word elements, or numbersHYPHENATE: to connect (words) or divide (a word, such as a word at the end of a line of print) with a hyphenINCEPTIVE: of verbs: denoting the beginning of an action, state, or occurrence; also, an inchoative verbINDEPENDENT: grammar: main, expressing the chief predication in a complex sentence (an independent clause)INFINITIVE: a verb form … that performs some functions of a noun and at the same time displays some characteristics of a verb and that is used with to except with auxiliary and various other verbsINFLECT: to vary (a word) by inflection: decline, conjugateLEMMA: an auxiliary proposition used in the demonstration of another propositionMADE: to form, to combine to make (a compound word)MAIN: expressing the chief predication in a complex sentence (the main clause)MAKE: to form, to combine to make (a compound word)MAKING: to form, to combine to make (a compound word)MIDDLE: of a verb form or voice: typically asserting that a person or thing both performs and is affected by the action representedMODAL: of, relating to, or constituting a grammatical form or category characteristically indicating predication of an action or state in some manner other than as a simple fact (a modal verb)MODE: in grammar, mood: distinction of form or a particular set of inflectional forms of a verb to express whether the action or state it denotes is conceived as fact or in some other manner (such as command, possibility, or wish) (the indicative mode, the subjunctive mode)MODIFY: to limit or restrict the meaning of especially in a grammatical construction (In the phrase "the red hat," the adjective "red" modifies the noun "hat.")MOOD: distinction of form or a particular set of inflectional forms of a verb to express whether the action or state it denotes is conceived as fact or in some other manner (such as command, possibility, or wish)NOMINAL: a word or word group functioning as a noun; also, of, relating to, or being a noun or a word or expressionNONFINITE: not finite (nonfinite clauses, nonfinite verbs)NOUN: any member of a class of words that typically can be combined with determiners to serve as the subject of a verb, can be interpreted as singular or plural, can be replaced with a pronoun, and refer to an entity, quality, state, action, or conceptOBJECT: a noun or noun equivalent (such as a pronoun, gerund, or clause) denoting the goal or result of the action of a verb; also, a noun or noun equivalent in a prepositional phrase (such as table in on the table)OPEN: of punctuation: characterized by sparing use especially of the comma when possible without causing misinterpretation; also, of a compound: having components separated by a space in writing or printing (such as opaque projector)PARADIGM: an example of a conjugation or declension showing a word in all its inflectional formsPLURAL: of, relating to, or constituting a class of grammatical forms usually used to denote more than one or in some languages more than twoPOINT: a punctuation mark, especially a period, a point . used to mark the end (as of a declarative sentence or an abbreviation); also, to mark the pauses or grammatical divisions in: to punctuatePOINTING: a punctuation mark, especially a period, a point . used to mark the end (as of a declarative sentence or an abbreviation); also, to mark the pauses or grammatical divisions in: to punctuatePRONOUN: any of a small set of words (such as I, she, he, you, it, we, or they) in a language that are used as substitutes for nouns or noun phrases and whose referents are named or understood in the context; also the third person personal pronouns (such as he/him, she/her, and they/them) that a person goes byPUNCTUATE: to mark or divide (written matter) with punctuation marks; to use punctuation marksQUOTE: a quotation mark —often used [said] orally to indicate the beginning of a direct quotation; also, to set off by quotation marksQUOTED: a quotation mark —often used [said] orally to indicate the beginning of a direct quotation; also, to set off by quotation marksQUOTING: a quotation mark —often used [said] orally to indicate the beginning of a direct quotation; also, to set off by quotation marksTELIC*: of verbs: characterizing an action that moves toward a goalTHAT: [many meanings, mostly conjunctional, etc.]VARIANT: one of two or more different spellings (such as labor and labour) or pronunciations (as of economics \ek-, ēk-\) of the same wordVOICE: distinction of form or a system of inflections of a verb to indicate the relation of the subject of the verb to the action which the verb expresses (active and passive voices)WEAK: of, relating to, or constituting a verb or verb conjugation that in English forms the past tense and past participle by adding the suffix -ed or -d or -t; also, of a noun or adjective declension in Germanic languages: retaining a lesser number of distinctions in case, number and genderWHICH: used as a function word to introduce a nonrestrictive relative clause and to modify a noun in that clause and to refer together with that noun to a word or word group in a preceding clause or to an entire preceding clause or sentence or longer unit of discourseWORD: the entire set of linguistic forms produced by combining a single base with various inflectional elements without change in the part of speech elements (The word go also has the forms goes, going, went, and gone.)
Language and Linguistics not diction
ADOPT: to take (a word from another language) into common use: borrowADOPTED: to take (a word from another language) into common use: borrowBILINGUAL: having or expressed in two languages; using or able to use two languages especially with equal fluencyBORROW: to adopt into one language from another (The English word "entrepreneur" was borrowed from French.)BORROWING: to adopt into one language from another (The English word "entrepreneur" was borrowed from French.)BOUND: always occurring in combination with another linguistic form (un- in unknown and -er in speaker are bound forms)BRANCH: linguistics: a language group less inclusive than a familyCOGNATE: related by descent from the same ancestral language (Spanish and French are cognate languages.) also, (noun) one that is cognate with another; also, of a word or morpheme: related by derivation, borrowing, or descent (English "eat" and German "essen" are cognate.); also, (noun) one that is cognate with another ("Eat" and "essen" are cognates.)CONNECTIVE: a linguistic form that connects words or word groupsCORPORA: plural of corpus, a collection of recorded utterances used as a basis for the descriptive analysis of a languageDENOTE: to serve as a linguistic expression of the notion of: to meanDRIFT: an assumed trend toward a general change in the structure of a language over a period of timeDROP: in linguistics: to leave (a letter representing a speech sound) unsounded (drop the g in running)DROPPING: in linguistics: to leave (a letter representing a speech sound) unsounded (drop the g in running)DUAL: linguistics: the dual [grammatical] number of a language; also, a linguistic form in the dualDUALLY: linguistics: the dual [grammatical] number of a language; also, a linguistic form in the dualENDING: one or more letters or syllables added to a word base especially in inflectionETYMA*: plural of etyma: an earlier form of a word in the same language or an ancestral language; or a word in a foreign language that is the source of a particular loanword; or a word or morpheme from which words are formed by composition or derivationETYMOLOGY: the history of a linguistic form (such as a word) shown by tracing its development since its earliest recorded occurrence in the language where it is found …; also, a branch of linguistics concerned with etymologiesETYMON*: an earlier form of a word in the same language or an ancestral language; or a word in a foreign language that is the source of a particular loanword; or a word or morpheme from which words are formed by composition or derivationFAMILY: a group of related languages descended from a single ancestral languageLANGUAGE: an organically developed system of communication used by groups of humans: such as the words, their pronunciation, their written representation, and the methods of combining them as used and understood by a community; also, a system of communication with a vocabulary and a grammar that uses hand gestures and their placement relative to the upper body, facial expressions, body postures, and finger spelling: sign languageLEXEME*: a meaningful linguistic unit that is an item in the vocabulary of a languageLEXICON: the vocabulary of a language, an individual speaker or group of speakers, or a subject (computer terms that have been added to the lexicon); also, a book containing an alphabetical arrangement of the words in a language and their definitions: a dictionary; also, the total stock of morphemes in a languageLOAN: (noun) a loanword, a word taken from another language and at least partly naturalizedMACRON: a mark − placed over a vowel to indicate that the vowel is long or placed over a syllable or used alone to indicate a stressed or long syllable in a metrical footMEANING: the logical connotation of a word or phrase; the logical denotation or extension of a word or phraseMEDIAL: situated between the extremes of initial and final in a word or morphemeMODIFY: to change (a vowel) by umlautMONOGLOT: monolingual: having or using only one languageMORPH: allomorph: one of a set of forms that a morpheme may take in different contexts; also, a distinctive collocation of phones (such as a portmanteau form) that serves as the realization of more than one morpheme in a context (such as the French du for the sequence of de and le); also, abbreviation of morphology, a study and description of word formation (such as inflection, derivation, and compounding) in language; also, the system of word-forming elements and processes in a languageMUTABLE: capable of or liable to mutation (mutable vowels)MUTE: contributing nothing to the pronunciation of a word (the b in plumb is mute); also, contributing to the pronunciation of a word but not representing the nucleus of a syllable (the e in mate is mute); also, a stop, a consonant characterized by complete closure of the breath passage in the course of articulationNONCE: occurring, used, or made only once or for a special occasion (a nonce word); the one, particular, or present occasion, purpose, or use (for the nonce)NONWORD: a word that has no meaning, is not known to exist, or is disapprovedNOTIONAL: presenting an idea of a thing, action, or quality (the word ‘has’ is notional in ‘he has luck,’ and relational in ‘he has gone’)NOTIONALITY: presenting an idea of a thing, action, or quality (the word ‘has’ is notional in ‘he has luck,’ and relational in ‘he has gone’)NUCLEI: plural of nucleus, the peak of sonority in the utterance of a syllablePENULT: the next to the last member of a series, especially: the second to last syllable of a word: the penultimaPHILOLOGY: linguistics, especially: historical and comparative linguistics; also, the study of human speech especially as the vehicle of literature and as a field of study that sheds light on cultural historyPHYLA: plural of phylum, a group of languages related more remotely than those of a family or stockPIDGIN: a simplified speech used for communication between people with different languagesPOLYGLOT: speaking or writing several languages: multilingual; also, one who is polyglot; also, a mixture or confusion of languages or nomenclatures; also, composed of numerous linguistic groups (a polyglot population); containing matter in several languages (a polyglot sign); composed of elements from different languagesPONY: a literal translation of a foreign language text, especially: one used surreptitiously by students in preparing or reciting lessons; also, not in M-W, in Collins: slang, to prepare (lessons) by means of a ponyRADICAL: of, relating to, or constituting a linguistic root, the simple element inferred as the basis from which a word is derived by phonetic change or by extension (such as composition or the addition of an affix or inflectional ending); also, a sound or letter belonging to a radicalROOT: the simple element inferred as the basis from which a word is derived by phonetic change or by extension (such as composition or the addition of an affix or inflectional ending)TALK: a way of speaking: language; also, to use (a language) for conversing or communicating; to convey information or communicate in any way (as with signs or sounds) (can make a trumpet talk, make the computer talk to the printer)TALKED: a way of speaking: language; also, to use (a language) for conversing or communicating; to convey information or communicate in any way (as with signs or sounds) (can make a trumpet talk, make the computer talk to the printer)THEMATIC: of or relating to the stem of a word; also, of a vowel: being the last part of a word stem before an inflectional endingTHEME: linguistics: the stem, the part of an inflected word that remains after the inflected part is removedTHORN: the runic letter þ used in Old English and Middle English to represent either of the fricatives \th\ or \t͟h\ and in Icelandic to represent \th\TONEME*: an intonation phoneme in a tone languageTONGUE: language, especially: a spoken languageTRIGRAM: a trigraph, a cluster of three successive letters (the, ion, and ing are high frequency trigraphs)TRIGRAPH: three letters spelling a single consonant, vowel, or diphthong (eau of beau is a trigraph); also, a cluster of three successive letters (the, ion, and ing are high frequency trigraphs)TROT: a literal translation of a foreign text [compare to PONY, a literal translation of a foreign language text, especially: one used surreptitiously by students in preparing or reciting lessons; also, not in M-W, in Collins: slang, to prepare (lessons) by means of a pony]TYPE: the form common to all instances of a linguistic elementUNILINGUAL: composed in or using one language onlyVARIANT: one of two or more words (such as geographic and geographical) or word elements (such as mon- and mono-) of essentially the same meaning differing only in the presence or absence of an affixVULGAR: the vernacular (the vulgar name of a plant)VULGARLY: the vernacular (the vulgar name of a plant)
Words about Words
ACCEPTANCE: acceptation: a generally accepted meaning of a word or understanding of a conceptACRONYM: a word (such as NATO, radar, or laser) formed from the initial letter or letters of each of the successive parts or major parts of a compound term; also,: an abbreviation (such as FBI) formed from initial letters: an initialismALLONYM*: a name that is assumed by an author but that actually belongs to another person, or a work published under the name of a person other than the authorANAGRAM: a word or phrase made by transposing the letters of another word or phrase; also, to anagrammatize, to transpose the letters in (a word or phrase) so as to form an anagramANAGRAMMING: a word or phrase made by transposing the letters of another word or phrase; also, to anagrammatize, to transpose the letters in (a word or phrase) so as to form an anagramANAPHOR: a word or phrase with an anaphoric function, “a word or phrase that takes its reference from another word or phrase and especially from a preceding word or phrase”ANAPHORA: repetition of a word or expression at the beginning of successive phrases, clauses, sentences, or verses especially for rhetorical or poetic effect or use of a grammatical substitute (such as a pronoun or a pro-verb) to refer to the denotation of a preceding word or group of wordsANONYM*: an anonymous person or a pseudonymANTONYM: a word of opposite meaningANTONYMY: a word of opposite meaningARCHAIC: having the characteristics of the language of the past and surviving chiefly in specialized usesBLEND: a word (such as brunch) produced by combining other words or parts of words; to blend words in that mannerBLENDED: a word (such as brunch) produced by combining other words or parts of words; to blend words in that mannerCLIP: to abbreviate in speech or writingCLIPPED: to abbreviate in speech or writingCODE: coded language: a word or phrase chosen in place of another word or phrase in order to communicate an attitude or meaning without stating it explicitlyCOMMON: vernacular (common names); also, denoting nominal relations by a single linguistic form that in a more highly inflected language might be denoted by two or more different forms (common gender, common case)DEFINE: to make a definition, a statement of the meaning of a word or word group or a sign or symbolDEFINED: to make a definition, a statement of the meaning of a word or word group or a sign or symbolDEFINING: to make a definition, a statement of the meaning of a word or word group or a sign or symbolDEMONYM: a word (such as Nevadan or Sooner) used to denote a person who inhabits or is native to a particular placeEXPLETIVE: a syllable, word, or phrase inserted to fill a vacancy (as in a sentence or a metrical line) without adding to the senseHOMOGRAPH: one of two or more words spelled alike but different in meaning or derivation or pronunciation (such as the bow of a ship, a bow and arrow)HOMONYM: a homophone or homograph; also, one of two or more words spelled and pronounced alike but different in meaning (such as the noun quail and the verb quail); also, a namesakeHOMONYMY: the quality or state of being homonymous, that is, ambiguous, or having the same designation, or of, relating to, or being homonymsHOMOPHONE: grammar: one of two or more words pronounced alike but different in meaning or derivation or spelling (such as the words to, too, and two)HOMOPHONIC: of or relating to homophonesIDIOM: an expression in the usage of a language that is peculiar to itself either in having a meaning that cannot be derived from the conjoined meanings of its elements (such as up in the air for "undecided") or in its grammatically atypical use of words (such as give way)IDIOMATIC: an expression in the usage of a language that is peculiar to itself either in having a meaning that cannot be derived from the conjoined meanings of its elements (such as up in the air for "undecided") or in its grammatically atypical use of words (such as give way)LABEL: a word or phrase used with a dictionary definition (e.g., “obsolete”) to provide additional informationLOGOPHILE: a lover of wordsMETONYM: a word used in metonymyMETONYMY: a figure of speech consisting of the use of the name of one thing for that of another of which it is an attribute or with which it is associated (such as "crown" in "lands belonging to the crown")MONONYM: Not in M-W. Collins: In British English, a person who is famous enough to be known only by one name, usually the first nameNONWORD: a word that has no meaning, is not known to exist, or is disapprovedTOPONYM: a place-name, the name of a geographic locality; back-formation from toponymyTOPONYMY: the place-names of a region or language or especially the etymological study of themULTIMA: the last syllable of a wordUNACCEPTANCE: lack of acceptance, acceptation: a generally accepted meaning of a word or understanding of a conceptVARIANT: one of two or more different spellings (such as labor and labour) or pronunciations (as of economics \ek-, ēk-\) of the same word; also, one of two or more words (such as geographic and geographical) or word elements (such as mon- and mono-) of essentially the same meaning differing only in the presence or absence of an affixWORD: a speech sound or series of speech sounds that symbolizes and communicates a meaning usually without being divisible into smaller units capable of independent use; also, a gesture or series of gestures that symbolizes and communicates a meaning of an object or concept: a sign, a fundamental linguistic unit that designates an object or relation or has a purely syntactic functionWORDILY: of or relating to words: verbal; using or containing many and usually too many wordsWORDY: of or relating to words: verbal; using or containing many and usually too many words
Spelling Bee words related to
WORDS AND LANGUAGE
ACCENTACCEPTANCEACRONYMACTIVEACUTEADJUNCTADOPTADOPTEDAFFIXAITCH*ALEPHALLONYM*ALPHAALPHABETANAGRAMANAGRAMMINGANALYZABLEANALYZEANALYZEDANALYZINGANAPHORANAPHORAANONYM*ANTONYMANTONYMYARCHAICAUGMENTAUXILIARYBALANCEBANGBETABILINGUALBLANKBLENDBLENDEDBORROWBORROWINGBOUNDBRANCHCAPITALCLIPCLIPPEDCODECOGNATECOLONCOMMACOMMONCOMPLETECOMPLEXCOMPOUNDCONCORDCONNECTIVECONTRACTCORPORADANGLEDANGLEDDANGLINGDATIVEDECLINEDECLINEDDEFINEDEFINEDDEFININGDEFINITEDELTADEMONYMDENOTEDEPENDENTDIACRITICDIACRITICALDIAGONALDITTODOTTEDDRIFTDROPDROPPINGDUALDUALLYELLIPTIC
ELLIPTICALENDINGEPICENEETYMA*ETYMOLOGYETYMON*EXPLETIVEFAMILYFEMININEFINITEFLATGAMMAGLYPHGRAMGRAMMARGRAMMARIANGRAPHGRAPHICHANGULHEADHIRAGANAHOMOGRAPHHOMONYMHOMONYMYHOMOPHONEHOMOPHONICHYPHENHYPHENATE
IDIOMIDIOMATICINCEPTIVEINDEPENDENTINFINITIVEINFLECTINITIALIOTAKAPPA
KAYSLABELLANGUAGELEMMALEXEME*LEXICONLOANLOGOGRAMLOGOPHILEMACRONMADEMAINMAKEMAKINGMEANINGMEDIALMETONYMMETONYMYMIDDLEMODALMODEMODIFYMONOGLOTMONONYMMOODMORPHMUTABLEMUTENOMINALNONCENONFINITENONWORDNOTIONALNOTIONALITYNOUNNUCLEIOBJECTOMEGAOMICRONOPENPARADIGMPENULTPHILOLOGYPHYLAPIDGINPLURALPOINTPOINTINGPOLYGLOTPONYPRONOUNPUNCTUATEQUOTEQUOTEDQUOTINGRABBINICRABBINICALRADICALROOTRUNICTALKTALKEDTELIC*THATTHEMATICTHEMETHETATHORNTILDETITTLETONEME*TONGUETOPONYMTOPONYMYTRIGRAMTRIGRAPHTROTTYPEULTIMAUMLAUTUNACCEPTANCEUNILINGUALVARIANTVOICEVULGARVULGARLYWEAKWHICHWORDWORDILYWORDYZETA